Showing Protein Dual specificity phosphatase DUPD1 (BMDBP00167)
| Identification | |
|---|---|
| BMDB Protein ID | BMDBP00167 |
| Secondary Accession Numbers | None |
| Name | Dual specificity phosphatase DUPD1 |
| Synonyms | Not Available |
| Gene Name | DUPD1 |
| Protein Type | Enzyme |
| Biological Properties | |
| General Function | Signal transduction mechanisms |
| Specific Function | Dual specificity phosphatase able to dephosphorylate phosphotyrosine, phosphoserine and phosphothreonine residues, with a preference for phosphotyrosine as a substrate. |
| Pathways | Not Available |
| Reactions | Not Available |
| GO Classification | Not Available |
| Cellular Location | Not Available |
| Gene Properties | |
| Chromosome Location | 28 |
| Locus | Not Available |
| SNPs | DUPD1 |
| Gene Sequence | Not Available |
| Protein Properties | |
| Number of Residues | 219 |
| Molecular Weight | 24984.0 |
| Theoretical pI | 6.4 |
| Pfam Domain Function | Not Available |
| Signals |
|
| Transmembrane Regions |
|
| Protein Sequence |
>Dual specificity phosphatase DUPD1 MTSGESKTGLKNVYPSAKKLLPKVEEGEAEDYCTPGAFELERLFWKGSPQYTHVNEVWPK LYIGDETTALDRYGLQKAGFTHVLNAAHGRWNVDTGPDYYRDMAIEYHGVEADDLPSFDL SVFFYPAAAFIDAALRYDHNKILVHCVMGRSRSATLVLAYLMIHRNMTLVDAIQQVAKNR CVLPNRGFLKQLRELDRQLVQQRRQAQQGEDAEKCEQEP |
| External Links | |
| GenBank ID Protein | Not Available |
| UniProtKB/Swiss-Prot ID | P0C591 |
| UniProtKB/Swiss-Prot Entry Name | DUPD1_BOVIN |
| PDB IDs | Not Available |
| GenBank Gene ID | BF074326 |
| GeneCard ID | DUPD1 |
| GenAtlas ID | Not Available |
| HGNC ID | Not Available |
| References | |
| General References | Not Available |