Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Bovine Metabolome Database.
Identification
BMDB Protein ID BMDBP00175
Secondary Accession Numbers None
Name ATP-citrate synthase
Synonyms Not Available
Gene Name ACLY
Protein Type Enzyme
Biological Properties
General Function Energy production and conversion
Specific Function Catalyzes the cleavage of citrate into oxaloacetate and acetyl-CoA, the latter serving as common substrate for de novo cholesterol and fatty acid synthesis.
Pathways
  • LPS and Citrate Signaling and Inflammation
  • Transfer of Acetyl Groups into Mitochondria
Reactions
Coenzyme A + Citric acid + Adenosine triphosphate → Oxalacetic acid + ADP + Acetyl-CoA details
GO Classification Not Available
Cellular Location Not Available
Gene Properties
Chromosome Location 19
Locus Not Available
SNPs ACLY
Gene Sequence
>3276 bp
ATGTCGGCCAAGGCGATTTCTGAGCAGACAGGCAAAGAGCTCCTCTACAAGTACATCTGC
ACCACCTCGGCCATCCAGAACCGCTTCAAGTATGCCCGGGTCACCCCTGACACAGACTGG
GCCCGCCTGTTGCAGGACCACCCGTGGCTGCTCAGCCAGAGCTTGGTGGTCAAGCCAGAC
CAGCTGATCAAACGGCGTGGAAAGCTGGGCCTAATTGGGGTCAACCTCACTCTGGATGGA
GTCAAGTCCTGGCTGAAGCCACGCCTGGGACAGGAAGCTACAGTTGGCAAGGCCACAGGC
TTCCTCAAGAACTTCCTGATCGAACCCTTCGTCCCCCACACTCAGGAGGAAGAGTTCTAC
GTCTGCATCTATGCTACCCGAGAAGGGGACTATGTCCTGTTCCACCACGAGGGTGGGGTG
GACGTGGGCGACGTGGATGCTAAAGCCCAGAAACTACTTGTCGGCGTCGATGAGAAGCTG
AATCCTGAGGACATCAAGAAACACCTGCTGGTCCACGCCCCCGAAGACAAGAAAGAAATT
CTGGCCAGCTTTATCTCCGGCCTCTTCAATTTCTATGAGGATCTGTACTTCACCTACCTC
GAGATCAACCCCCTTGTCGTGACCAAAGATGGCGTCTACGTCCTTGACTTGGCCGCCAAG
GTGGATGCCACTGCCGACTACATCTGCAAAGTGAAGTGGGGTGACATAGAGTTCCCACCC
CCCTTCGGACGGGAGGCTTACCCAGAGGAAGCCTACATCGCAGATCTGGACGCCAAAAGT
GGGGCAAGCTTGAAGCTGACTTTACTGAATCCCAAGGGGAGAATCTGGACCATGGTGGCC
GGAGGGGGTGCCTCTGTCGTGTACAGTGACACCATCTGCGACCTGGGGGGTGTCAACGAG
CTGGCAAACTACGGGGAGTACTCGGGCGCCCCCAGCGAGCAGCAGACCTATGACTACGCC
AAGACGATCCTCTCCCTTATGACCCGCGAGAAGCACCCAGATGGCAAGATCCTCATCATC
GGAGGCAGCATCGCAAACTTCACCAACGTGGCTGCCACATTCAAGGGCATCGTGAGAGCA
ATTCGAGATTACCAGGGTCCCCTGAAGGAGCACGAGGTCACGATCTTTGTCCGAAGAGGT
GGCCCCAACTATCAGGAGGGCTTACGGGTCATGGGAGAAGTCGGGAAGACCACTGGGATC
CCCATCCATGTCTTCGGCACTGAGACTCACATGACGGCCATCGTGGGCATGGCCCTGGGC
CATCGGCCCATCCCCAATCAGCCGCCCACAGCGGCCCACACCGCAAACTTCCTCCTCAAC
GCCAGCGGGAGTACTTCAACTCCAGCCCCCAGCAGGACGGCATCTTTTTCTGAGTCCAGA
ACTGATGAGGTGGCCCCTGCCAAGAAGGCCAAGCCTGCCATGCTCCAAGGAAAGAGCGCC
ACCCTCTTCAGCCGCCACACCAAGGCCATCGTGTGGGGCATGCAGACCCGGGCTGTGCAG
GGCATGCTGGACTTCGACTACGTCTGCTCCCGCGACGAGCCCTCAGTGGCTGCCATGGTC
TACCCGTTCACTGGGGACCACAAACAGAAGTTTTACTGGGGTCACAAGGAGATCCTGATC
CCCGTCTTTAAGAACATGGCTGATGCCATGAAGAAGCACCCAGAGGTAGACGTGCTAATC
AACTTTGCCTCCCTGCGCTCAGCCTACGACAGCACCATGGAGACCATGAATTACGCTCAG
ATCCGGACCATCGCCATCATAGCCGAAGGCATCCCTGAGGCGCTCACGAGGAAGCTGATC
AAGAAGGCAGACCAGAAGGGAGTGACCATCATTGGACCTGCCACCGTTGGTGGCATCAAG
CCCGGGTGCTTTAAGATCGGGAACACCGGCGGGATGCTGGACAACATCCTGGCCTCTAAG
CTGTACCGCCCAGGCAGTGTGGCCTATGTCTCGCGTTCGGGTGGCATGTCCAACGAGCTC
AACAATATCATCTCTCGAACCACAGATGGCGTCTACGAGGGCGTGGCCATTGGTGGGGAC
AGGTACCCCGGCTCAACGTTTATGGATCACGTGTTACGTTATCAGGACACTGCAGGAGTC
AAAATGATTGTGGTTCTTGGAGAGATAGGGGGCACAGAGGAGTATAAGATCTGCCGGGGC
GTCACGGAGGGCCGCATCACCAAGCCCGTGGTCTGCTGGTGCATCGGGACCTGTGCGGCC
ATGTTCTCCTCCGAGGTCCAGTTCGGCCACGCTGGAGCTTGTGCCAACCAGGCTTCTGAA
ACCGCAGTTGCCAAGAACCAGGCCTTGAAGGAGGCTGGAGTGTTTGTGCCCCGGAGCTTC
GATGAGCTTGGAGAAATCATCCAGTCCGTGTACGAGGATCTCGTGGCCAGAGGAGTCATT
GTGCCTGCTCAGGAGGTTCCGCCCCCCACAGTACCCATGGACTACTCTTGGGCCCGGGAA
TTGGGCTTGATCCGCAAACCTGCCTCGTTCATGACCAGCATCTGTGACGAGCGAGGACAG
GAGCTCATCTACGCGGGCATGCCCATCACTGAGGTCTTCAAGGAGGAGATGGGCATTGGC
GGGGTCCTCGGCCTCCTCTGGTTCCAGAAAAGGTTGCCCAAATACTCCTGCCAGTTCATT
GAGATGTGCCTGATGGTGACGGCTGATCACGGGCCTGCCGTCTCTGGGGCTCATAACACC
ATCATCTGCGCTCGAGCCGGCAAGGACCTCGTCTCCAGCCTCACCTCGGGACTGCTTACC
ATTGGCGACCGGTTTGGGGGTGCCCTGGATGCAGCAGCCAAGATGTTCAGCAAGGCCTTT
GACAGTGGTATCATCCCCATGGAGTTTGTGAACAAGATGAAGAAGGAAGGAAAGCTTATC
ATGGGCATTGGTCACCGAGTGAAGTCGATCAACAACCCAGACATGCGCGTGCAGATTCTC
AAAGATTATGTCAGACAACACTTCCCTGCCACCCCACTGCTCGACTACGCACTGGAAGTA
GAGAAGATTACCACTTCCAAGAAACCAAACCTTATCCTGAATGTGGACGGTTTAATCGGA
GTTGCATTTGTAGACATGCTTAGACACTGCGGGTCCTTCACTCGGGAGGAAGCTGATGAA
TATATTGACATTGGAGCCCTCAACGGCATCTTTGTGCTGGGAAGGAGCATGGGCTTCATT
GGACACTATCTTGATCAGAAGAGGCTGAAGCAGGGGCTCTACCGTCACCCATGGGATGAT
ATTTCATATGTTCTTCCGGAACACATGAGCATGTAA
Protein Properties
Number of Residues 1091
Molecular Weight 119789.0
Theoretical pI 7.25
Pfam Domain Function Not Available
Signals
  • None
Transmembrane Regions Not Available
Protein Sequence
>ATP-citrate synthase
MSAKAISEQTGKELLYKYICTTSAIQNRFKYARVTPDTDWARLLQDHPWLLSQSLVVKPD
QLIKRRGKLGLIGVNLTLDGVKSWLKPRLGQEATVGKATGFLKNFLIEPFVPHTQEEEFY
VCIYATREGDYVLFHHEGGVDVGDVDAKAQKLLVGVDEKLNPEDIKKHLLVHAPEDKKEI
LASFISGLFNFYEDLYFTYLEINPLVVTKDGVYVLDLAAKVDATADYICKVKWGDIEFPP
PFGREAYPEEAYIADLDAKSGASLKLTLLNPKGRIWTMVAGGGASVVYSDTICDLGGVNE
LANYGEYSGAPSEQQTYDYAKTILSLMTREKHPDGKILIIGGSIANFTNVAATFKGIVRA
IRDYQGPLKEHEVTIFVRRGGPNYQEGLRVMGEVGKTTGIPIHVFGTETHMTAIVGMALG
HRPIPNQPPTAAHTANFLLNASGSTSTPAPSRTASFSESRTDEVAPAKKAKPAMLQGKSA
TLFSRHTKAIVWGMQTRAVQGMLDFDYVCSRDEPSVAAMVYPFTGDHKQKFYWGHKEILI
PVFKNMADAMKKHPEVDVLINFASLRSAYDSTMETMNYAQIRTIAIIAEGIPEALTRKLI
KKADQKGVTIIGPATVGGIKPGCFKIGNTGGMLDNILASKLYRPGSVAYVSRSGGMSNEL
NNIISRTTDGVYEGVAIGGDRYPGSTFMDHVLRYQDTAGVKMIVVLGEIGGTEEYKICRG
VTEGRITKPVVCWCIGTCAAMFSSEVQFGHAGACANQASETAVAKNQALKEAGVFVPRSF
DELGEIIQSVYEDLVARGVIVPAQEVPPPTVPMDYSWARELGLIRKPASFMTSICDERGQ
ELIYAGMPITEVFKEEMGIGGVLGLLWFQKRLPKYSCQFIEMCLMVTADHGPAVSGAHNT
IICARAGKDLVSSLTSGLLTIGDRFGGALDAAAKMFSKAFDSGIIPMEFVNKMKKEGKLI
MGIGHRVKSINNPDMRVQILKDYVRQHFPATPLLDYALEVEKITTSKKPNLILNVDGLIG
VAFVDMLRHCGSFTREEADEYIDIGALNGIFVLGRSMGFIGHYLDQKRLKQGLYRHPWDD
ISYVLPEHMSM
GenBank ID Protein AAI08139.1
UniProtKB/Swiss-Prot ID Q32PF2
UniProtKB/Swiss-Prot Entry Name ACLY_BOVIN
PDB IDs Not Available
GenBank Gene ID BC108138
GeneCard ID ACLY
GenAtlas ID Not Available
HGNC ID Not Available
References
General References Not Available