You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Bovine Metabolome Database.
Identification
BMDB Protein ID BMDBP00179
Secondary Accession Numbers None
Name Tyrosine-protein kinase
Synonyms Not Available
Gene Name YES1
Protein Type Enzyme
Biological Properties
General Function Involved in ATP binding
Specific Function Not Available
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location Not Available
Gene Properties
Chromosome Location 24
Locus Not Available
SNPs YES1
Gene Sequence
>1626 bp
ATGGGCTGCATTAAAAGTAAAGAGAACAAAAGTCCATCCATTAAATATAGACCAGAAAAC
ACGCCAGAGCCGGTCAGCACAGGAGTAGGCCATTATGGAGGAGAACACGCTGTGGTGGCA
CCAACATCCTCCACGAAGAGCACATCTGCCAATTTCAGCAGCCTCTCCATGACGCCATTC
GGAGGGTCCTCGGCGGTGACACCTTTTGGAGGAGCATCTTCCTCGTTTTCAGTGGTGCCA
AGTTCATATCCTGCTGGTTTAACAGGTGGTGTTACTATATTTGTGGCCTTATATGATTAT
GAAGCTAGAACTACAGAAGACCTTTCATTTAAGAAAGGTGAAAGATTTCAAATAATTAAC
AACACGGAAGGAGACTGGTGGGAGGCGAGATCAATCGCTACAGGAAAGAACGGCTACATC
CCAAGCAATTACGTAGCCCCGGCGGATTCCATTCAGGCTGAAGAATGGTATTTTGGCAAA
ATGGGGAGAAAAGATGCGGAAAGATTACTTCTGAATCCTGGGAATCAGCGAGGTATTTTC
TTAGTAAGAGAGAGTGAAACTACTAAAGGTGCTTACTCCCTCTCTATTCGGGACTGGGAT
GAGGTGAGGGGTGACAATGTGAAGCACTACAAAATTAGGAAACTTGACAATGGTGGATAC
TACATCACAACCAGAGCACAGTTTGACACTCTGCAGAAACTGGTAAAACACTACACAGAA
CATGCCGATGGTTTATGCCATAAGTTAACAACTGTGTGTCCAACTGTGAAACCCCAGACT
CAAGGTCTAGCAAAAGATGCTTGGGAAATCCCGCGAGAATCTTTGCGACTAGAGGTTAAA
CTAGGACAAGGATGTTTTGGTGAAGTTTGGATGGGAACGTGGAATGGAACCACAAAAGTA
GCGATCAAAACACTGAAGCCAGGTACAATGATGCCAGAAGCTTTTCTTCAAGAGGCTCAG
ATAATGAAAAAACTAAGACATGATAAACTTGTTCCACTATATGCTGTTGTTTCTGAAGAG
CCGATTTACATTGTCACTGAGTTTATGTCAAAAGGGAGCTTATTGGATTTCCTGAAGGAG
GGAGATGGAAAGTATCTGAAGCTCCCACAGCTGGTTGACATGGCTGCTCAGATTGCTGAT
GGTATGGCCTATATTGAAAGAATGAACTATATTCATCGAGATCTTCGGGCTGCTAATATT
CTCGTAGGCGAAAACCTTGTGTGCAAAATAGCAGATTTTGGCTTAGCAAGGTTAATTGAA
GACAATGAATATACGGCAAGACAAGGTGCAAAATTTCCAATCAAGTGGACAGCTCCTGAG
GCTGCACTGTATGGTCGATTTACAATCAAGTCTGATGTATGGTCATTTGGAATTCTACAG
ACAGAACTGGTAACAAAGGGCAGAGTGCCATATCCAGGTATGGTGAACCGCGAGGTGCTG
GAGCAGGTGGAGCGAGGGTACAGGATGCCATGCCCGCAGGGCTGCCCAGAGTCCCTCCAC
GAATTGATGAATCTGTGTTGGAAGAAGGACCCTGATGAGAGACCAACATTTGAGTATATC
CAGTCCTTCCTGGAAGACTATTTCACTGCTACAGAGCCACAGTACCAGCCAGGAGAAAAT
TTATAA
Protein Properties
Number of Residues 541
Molecular Weight 60597.0
Theoretical pI 6.79
Pfam Domain Function Not Available
Signals
  • None
Transmembrane Regions Not Available
Protein Sequence
>YES1 protein
MGCIKSKENKSPSIKYRPENTPEPVSTGVGHYGGEHAVVAPTSSTKSTSANFSSLSMTPF
GGSSAVTPFGGASSSFSVVPSSYPAGLTGGVTIFVALYDYEARTTEDLSFKKGERFQIIN
NTEGDWWEARSIATGKNGYIPSNYVAPADSIQAEEWYFGKMGRKDAERLLLNPGNQRGIF
LVRESETTKGAYSLSIRDWDEVRGDNVKHYKIRKLDNGGYYITTRAQFDTLQKLVKHYTE
HADGLCHKLTTVCPTVKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTKV
AIKTLKPGTMMPEAFLQEAQIMKKLRHDKLVPLYAVVSEEPIYIVTEFMSKGSLLDFLKE
GDGKYLKLPQLVDMAAQIADGMAYIERMNYIHRDLRAANILVGENLVCKIADFGLARLIE
DNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILQTELVTKGRVPYPGMVNREVL
EQVERGYRMPCPQGCPESLHELMNLCWKKDPDERPTFEYIQSFLEDYFTATEPQYQPGEN
L
GenBank ID Protein AAI51349.1
UniProtKB/Swiss-Prot ID A7MB57
UniProtKB/Swiss-Prot Entry Name A7MB57_BOVIN
PDB IDs Not Available
GenBank Gene ID BC151348
GeneCard ID YES1
GenAtlas ID Not Available
HGNC ID Not Available
References
General References Not Available