Showing Protein Acylphosphatase-2 (BMDBP00192)
| Identification | |
|---|---|
| BMDB Protein ID | BMDBP00192 |
| Secondary Accession Numbers | None |
| Name | Acylphosphatase-2 |
| Synonyms | Not Available |
| Gene Name | ACYP2 |
| Protein Type | Enzyme |
| Biological Properties | |
| General Function | Energy production and conversion |
| Specific Function | Its physiological role is not yet clear. |
| Pathways | Not Available |
| Reactions | Not Available |
| GO Classification | Not Available |
| Cellular Location | Not Available |
| Gene Properties | |
| Chromosome Location | 11 |
| Locus | Not Available |
| SNPs | ACYP2 |
| Gene Sequence | Not Available |
| Protein Properties | |
| Number of Residues | 99 |
| Molecular Weight | 11178.0 |
| Theoretical pI | 10.2 |
| Pfam Domain Function | Not Available |
| Signals |
|
| Transmembrane Regions | Not Available |
| Protein Sequence |
>Acylphosphatase-2 MSTGRPLKSVDYEVFGRVQGVCFRMYTEDEARKIGVVGWVKNTSKGTVTGQVQGPEEKVN SMKSWLSKVGSPSSRIDRTNFSNEKTISKLEYSSFNIRY |
| External Links | |
| GenBank ID Protein | Not Available |
| UniProtKB/Swiss-Prot ID | P07033 |
| UniProtKB/Swiss-Prot Entry Name | ACYP2_BOVIN |
| PDB IDs | |
| GenBank Gene ID | Not Available |
| GeneCard ID | ACYP2 |
| GenAtlas ID | Not Available |
| HGNC ID | Not Available |
| References | |
| General References | Not Available |