You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Bovine Metabolome Database.
Identification
BMDB Protein ID BMDBP00205
Secondary Accession Numbers None
Name Activin receptor type-1
Synonyms Not Available
Gene Name ACVR1
Protein Type Enzyme
Biological Properties
General Function Involved in activin receptor activity, type I
Specific Function On ligand binding, forms a receptor complex consisting of two type II and two type I transmembrane serine/threonine kinases. Type II receptors phosphorylate and activate type I receptors which autophosphorylate, then bind and activate SMAD transcriptional regulators. Receptor for TGF-beta. May also bind activin.
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location Not Available
Gene Properties
Chromosome Location 2
Locus Not Available
SNPs ACVR1
Gene Sequence
>1530 bp
ATGGTGGATGGAGTGATGATTCTTCCTGTGCTCGTGATGATTGCTTTCCCTTTCCCTAGT
ATGGAAGATGAGAAGCCCAAGGTAAACCCCAAGCTTTACATGTGTGTGTGTGAAGGCCTC
TCCTGTGGGGATGAGGCCCACTGTGAAGGCCAGCAGTGCTTTTCCTCGCTGAGCATAAAT
GATGGCTTCCACGTCTACCAGAAAGGCTGCTTCCAGGTCTACGAGCAGGGGAAGATGACC
TGTAAGACCCCGCCGTCACCTGGCCAGGCTGTGGAGTGCTGCCAAGGGGACTGGTGTAAC
AGGAACATCACGGCCCAGCTGCCTACTAAAGGGAAATCTTTTCCTGGAACACAGAATTTC
CACTTGGAGGTTGGCCTCATCATTTTGTCTGTAGTGTTCGCAGTATGCCTTCTAGCCTGC
CTATTGGGAGTTGCTCTCCGAAAATTTAAAAGGCGCAATCAAGAACGCCTCAACCCCAGA
GATGTGGAATATGGCACCATTGAAGGACTCATCACCACCAACGTTGGAGACAGCACTTTA
GCAGATTTATTGGATCATTCATGTACATCGGGAAGCGGCTCTGGCCTTCCTTTTCTGGTA
CAGAGAACAGTGGCCCGTCAGATCACACTGCTGGAGTGTGTTGGGAAGGGCAGGTATGGC
GAGGTGTGGAGGGGCAGCTGGCAAGGGGAGAACGTCGCTGTGAAGATCTTTTCCTCCCGG
GATGAGAAGTCGTGGTTTAGGGAAACAGAATTGTACAACACTGTGATGCTGAGGCATGAA
AATATCTTAGGTTTCATTGCTTCAGACATGACATCAAGACACTCCAGTACACAGTTGTGG
TTGATCACACATTATCATGAAATGGGATCGCTGTACGACTACCTTCAGCTTACTACTCTG
GATACAGTGAGCTGCCTGAGAATAGTGCTGTCCATAGCGAGCGGTCTCGCACATTTGCAC
ATAGAGATCTTTGGGACCCAAGGGAAACCGGCCATTGCTCACCGAGATCTAAAAAGCAAA
AACATCCTGGTTAAGAAGAATGGACAGTGTTGCATAGCAGATTTGGGCCTGGCAGTCATG
CATTCCCAGAGCACCAATCAGCTCGATGTGGGGAACAACCCCCGTGTGGGCACCAAACGC
TACATGGCCCCCGAAGTTCTTGATGAAACTATCCAGGTGGATTGTTTCGATTCTTACAAG
AGAGTCGATATTTGGGCCTTTGGACTTGTCTTGTGGGAGGTGGCCAGGCGGATGGTGAGC
AATGGTATTGTGGAGGATTACAAGCCACCATTCTATGATGTGGTTCCCAATGACCCAAGT
TTTGAAGATATGAGGAAGGTAGTCTGTGTGGATCAACAGAGGCCTAACATACCCAACAGA
TGGTTCTCAGACCCGACATTAACCTCCCTGGCCAAGCTGATGAAAGAATGCTGGTATCAA
AATCCATCTGCCAGACTCACAGCCCTGCGTATCAAAAAGACTTTGACCAAAATTGATAAT
TCCCTAGACAAATTGAAAACTGACTGTTGA
Protein Properties
Number of Residues 509
Molecular Weight 57190.0
Theoretical pI 7.36
Pfam Domain Function Not Available
Signals
  • 1-20
Transmembrane Regions
  • 124-146
Protein Sequence
>Activin receptor type-1
MVDGVMILPVLVMIAFPFPSMEDEKPKVNPKLYMCVCEGLSCGDEAHCEGQQCFSSLSIN
DGFHVYQKGCFQVYEQGKMTCKTPPSPGQAVECCQGDWCNRNITAQLPTKGKSFPGTQNF
HLEVGLIILSVVFAVCLLACLLGVALRKFKRRNQERLNPRDVEYGTIEGLITTNVGDSTL
ADLLDHSCTSGSGSGLPFLVQRTVARQITLLECVGKGRYGEVWRGSWQGENVAVKIFSSR
DEKSWFRETELYNTVMLRHENILGFIASDMTSRHSSTQLWLITHYHEMGSLYDYLQLTTL
DTVSCLRIVLSIASGLAHLHIEIFGTQGKPAIAHRDLKSKNILVKKNGQCCIADLGLAVM
HSQSTNQLDVGNNPRVGTKRYMAPEVLDETIQVDCFDSYKRVDIWAFGLVLWEVARRMVS
NGIVEDYKPPFYDVVPNDPSFEDMRKVVCVDQQRPNIPNRWFSDPTLTSLAKLMKECWYQ
NPSARLTALRIKKTLTKIDNSLDKLKTDC
GenBank ID Protein AAB02696.1
UniProtKB/Swiss-Prot ID Q28041
UniProtKB/Swiss-Prot Entry Name ACVR1_BOVIN
PDB IDs Not Available
GenBank Gene ID U58095
GeneCard ID ACVR1
GenAtlas ID Not Available
HGNC ID Not Available
References
General References Not Available