You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Bovine Metabolome Database.
Identification
BMDB Protein ID BMDBP00211
Secondary Accession Numbers None
Name Tyrosine-protein kinase
Synonyms Not Available
Gene Name JAK1
Protein Type Enzyme
Biological Properties
General Function Involved in ATP binding
Specific Function Not Available
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location Not Available
Gene Properties
Chromosome Location 3
Locus Not Available
SNPs JAK1
Gene Sequence Not Available
Protein Properties
Number of Residues 772
Molecular Weight 88606.0
Theoretical pI 6.98
Pfam Domain Function Not Available
Signals
  • None
Transmembrane Regions
  • 124-146
Protein Sequence
>Tyrosine-protein kinase
QDNKKMELKLSSHEEALSFVSLVDGYFRLTADAHHYLCTDVAPPLIVHNIQNGCHGPICT
EYAINKLRQEGSEEGMYVLRWSCTDFDNILMTVTCFEKSEVLGIQKQFKNFQIEVQKGRY
SLHGSDRSFPSLGDLMSHLKKQILRTDNISFVLKRCCQPKPREISNLLVATKKAQEWQPV
YTMSQLSFDRILKKDITQGEHLGRGTRTHIYSGTLTDYKDDEGTSEEKRIKVILKVLDPS
HRDISLAFFEAASMMRQVSHKHIVYLYGVCVRDVENIMVEEFVEGGPLDLFMHRKSDVLT
TPWKFKVAKQLASALSYLEDKDLVHGNVCTKNLLLAREGIDSECGPFIKLSDPGIPITVL
SRQECIERIPWIAPECVEDSKNLSVAADKWSFGTTLWEICYNGEIPLKDKTLIEKERFYE
SRCRPVTPSCKELADLMTRCMNYDPNQRPFFRAIMRDINKLEEQNPDIVSEKKPTTEVDP
THFEKRFLKRIRDLGEGHFGKVELCRYDPEGDNTGEQVAVKSLKPESGGNHIADLKKEIE
ILRNLYHENIVKYKGICTEDGGNGIKLIMEFLPSGSLKEYLPKNKNKINLKQQLKYAVQI
CKGMDYLGSRQYVHRDLAARNVLVESEHQVKIGDFGLTKAIETDKEYYTVKDDRDSPVFW
YAPECLIQCKFYIASDVWSFGVTLHELLTYCDSDSSPMALFLKMIGPTHGQMTVTRLVNT
LKEGKRLPCPPNCPDEVYQHMRKCWEFQPSNRTTFQNLIEGFEALLRSMSNI
GenBank ID Protein AAI33421.1
UniProtKB/Swiss-Prot ID A3KMY9
UniProtKB/Swiss-Prot Entry Name A3KMY9_BOVIN
PDB IDs Not Available
GenBank Gene ID BC133420
GeneCard ID JAK1
GenAtlas ID Not Available
HGNC ID Not Available
References
General References Not Available