Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Bovine Metabolome Database.
Identification
BMDB Protein ID BMDBP00212
Secondary Accession Numbers None
Name Dihydroxyacetone phosphate acyltransferase
Synonyms Not Available
Gene Name GNPAT
Protein Type Enzyme
Biological Properties
General Function Lipid transport and metabolism
Specific Function Not Available
Pathways
  • Cardiolipin Biosynthesis
  • Cardiolipin Biosynthesis CL(16:0/16:0/16:0/16:0)
  • Cardiolipin Biosynthesis CL(16:0/16:0/16:0/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/16:0/18:0)
  • Cardiolipin Biosynthesis CL(16:0/16:0/16:0/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/16:0/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/16:0/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/16:0/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/16:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/16:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/16:1(9Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/16:0/16:1(9Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/16:1(9Z)/18:0)
  • Cardiolipin Biosynthesis CL(16:0/16:0/16:1(9Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/16:1(9Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/16:1(9Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/16:1(9Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/18:0/16:0)
  • Cardiolipin Biosynthesis CL(16:0/16:0/18:0/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/18:0/18:0)
  • Cardiolipin Biosynthesis CL(16:0/16:0/18:0/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/18:0/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/18:0/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/18:0/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/18:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/18:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/18:1(11Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/16:0/18:1(11Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/18:1(11Z)/18:0)
  • Cardiolipin Biosynthesis CL(16:0/16:0/18:1(11Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/18:1(11Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/18:1(11Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/18:1(11Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/18:1(9Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/16:0/18:1(9Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/18:1(9Z)/18:0)
  • Cardiolipin Biosynthesis CL(16:0/16:0/18:1(9Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/18:1(9Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/18:1(9Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/18:1(9Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/18:2(9Z,12Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/16:0/18:2(9Z,12Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/18:2(9Z,12Z)/18:0)
  • Cardiolipin Biosynthesis CL(16:0/16:0/18:2(9Z,12Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/18:2(9Z,12Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/20:4(5Z,8Z,11Z,14Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/16:0/20:4(5Z,8Z,11Z,14Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/20:4(5Z,8Z,11Z,14Z)/18:0)
  • Cardiolipin Biosynthesis CL(16:0/16:0/20:4(5Z,8Z,11Z,14Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/20:4(5Z,8Z,11Z,14Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/22:5(4Z,7Z,10Z,13Z,16Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/16:0/22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/22:5(4Z,7Z,10Z,13Z,16Z)/18:0)
  • Cardiolipin Biosynthesis CL(16:0/16:0/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/22:5(7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/16:0/22:5(7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/22:5(7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(16:0/16:0/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(16:0/16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/16:1(9Z)/16:0/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/16:1(9Z)/16:0/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:0/16:1(9Z)/16:0/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/16:1(9Z)/16:0/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:0/16:1(9Z)/16:0/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:0/16:1(9Z)/16:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:0/16:1(9Z)/16:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/16:1(9Z)/16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/16:1(9Z)/16:1(9Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/16:1(9Z)/16:1(9Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/16:1(9Z)/16:1(9Z)/18:0)
  • Cardiolipin Biosynthesis CL(16:0/16:1(9Z)/16:1(9Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:0/16:1(9Z)/16:1(9Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/16:1(9Z)/16:1(9Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:0/16:1(9Z)/16:1(9Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:0/16:1(9Z)/16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:0/16:1(9Z)/16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/16:1(9Z)/16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/16:1(9Z)/18:0/16:0)
  • Cardiolipin Biosynthesis CL(16:0/16:1(9Z)/18:0/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/16:1(9Z)/18:0/18:0)
  • Cardiolipin Biosynthesis CL(16:0/16:1(9Z)/18:1(11Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/16:1(9Z)/18:1(11Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/16:1(9Z)/18:1(11Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:0/16:1(9Z)/18:1(11Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/16:1(9Z)/18:1(9Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/16:1(9Z)/18:1(9Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/16:1(9Z)/18:1(9Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:0/16:1(9Z)/18:1(9Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/16:1(9Z)/18:2(9Z,12Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/16:1(9Z)/18:2(9Z,12Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/16:1(9Z)/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:0/16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:0/16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:0/16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:0/16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/18:0/16:0/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/18:0/16:0/18:0)
  • Cardiolipin Biosynthesis CL(16:0/18:0/16:0/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:0/18:0/16:0/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/18:0/16:0/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:0/18:0/16:0/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:0/18:0/16:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:0/18:0/16:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/18:0/16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/18:0/16:1(9Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/18:0/16:1(9Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/18:0/16:1(9Z)/18:0)
  • Cardiolipin Biosynthesis CL(16:0/18:0/18:0/16:0)
  • Cardiolipin Biosynthesis CL(16:0/18:0/18:0/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/18:0/18:0/18:0)
  • Cardiolipin Biosynthesis CL(16:0/18:0/18:0/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:0/18:0/18:0/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/18:0/18:0/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:0/18:0/18:0/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:0/18:0/18:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:0/18:0/18:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/18:0/18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/18:0/18:1(11Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/18:0/18:1(11Z)/18:0)
  • Cardiolipin Biosynthesis CL(16:0/18:0/18:1(11Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:0/18:0/18:1(11Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/18:0/18:1(9Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/18:0/18:1(9Z)/18:0)
  • Cardiolipin Biosynthesis CL(16:0/18:0/18:1(9Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:0/18:0/18:1(9Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/18:0/18:2(9Z,12Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/18:0/18:2(9Z,12Z)/18:0)
  • Cardiolipin Biosynthesis CL(16:0/18:0/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:0/18:0/20:4(5Z,8Z,11Z,14Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/18:0/20:4(5Z,8Z,11Z,14Z)/18:0)
  • Cardiolipin Biosynthesis CL(16:0/18:0/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:0/18:0/22:5(4Z,7Z,10Z,13Z,16Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/18:0/22:5(4Z,7Z,10Z,13Z,16Z)/18:0)
  • Cardiolipin Biosynthesis CL(16:0/18:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:0/18:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/18:0/22:5(7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/18:0/22:5(7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(16:0/18:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:0/18:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(16:0/18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(11Z)/16:0/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(11Z)/16:0/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(11Z)/16:0/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(11Z)/16:0/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(11Z)/16:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(11Z)/16:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(11Z)/16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(11Z)/16:1(9Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/18:1(11Z)/16:1(9Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(11Z)/16:1(9Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(11Z)/16:1(9Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(11Z)/18:0/16:0)
  • Cardiolipin Biosynthesis CL(16:0/18:1(11Z)/18:0/18:0)
  • Cardiolipin Biosynthesis CL(16:0/18:1(11Z)/18:0/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(11Z)/18:0/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(11Z)/18:1(11Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/18:1(11Z)/18:1(11Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(11Z)/18:1(11Z)/18:0)
  • Cardiolipin Biosynthesis CL(16:0/18:1(11Z)/18:1(11Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(11Z)/18:1(11Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(11Z)/18:1(11Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(11Z)/18:1(11Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(11Z)/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(11Z)/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(11Z)/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(11Z)/18:1(9Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/18:1(11Z)/18:1(9Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(11Z)/18:1(9Z)/18:0)
  • Cardiolipin Biosynthesis CL(16:0/18:1(11Z)/18:1(9Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(11Z)/18:1(9Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(11Z)/18:1(9Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(11Z)/18:1(9Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(11Z)/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(11Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(11Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(11Z)/18:2(9Z,12Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/18:1(11Z)/18:2(9Z,12Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(11Z)/18:2(9Z,12Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(11Z)/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(9Z)/16:0/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(9Z)/16:0/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(9Z)/16:0/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(9Z)/16:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(9Z)/16:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(9Z)/16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(9Z)/16:1(9Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/18:1(9Z)/16:1(9Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(9Z)/16:1(9Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(9Z)/16:1(9Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(9Z)/18:0/16:0)
  • Cardiolipin Biosynthesis CL(16:0/18:1(9Z)/18:0/18:0)
  • Cardiolipin Biosynthesis CL(16:0/18:1(9Z)/18:0/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(9Z)/18:0/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(9Z)/18:1(11Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/18:1(9Z)/18:1(11Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(9Z)/18:1(11Z)/18:0)
  • Cardiolipin Biosynthesis CL(16:0/18:1(9Z)/18:1(11Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(9Z)/18:1(11Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(9Z)/18:1(11Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(9Z)/18:1(11Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(9Z)/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(9Z)/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(9Z)/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(9Z)/18:1(9Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/18:1(9Z)/18:1(9Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(9Z)/18:1(9Z)/18:0)
  • Cardiolipin Biosynthesis CL(16:0/18:1(9Z)/18:1(9Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(9Z)/18:1(9Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(9Z)/18:1(9Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(9Z)/18:1(9Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(9Z)/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(9Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(9Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(9Z)/18:2(9Z,12Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/18:1(9Z)/18:2(9Z,12Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(9Z)/18:2(9Z,12Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(9Z)/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/18:2(9Z,12Z)/16:0/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:0/18:2(9Z,12Z)/16:0/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:0/18:2(9Z,12Z)/16:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:0/18:2(9Z,12Z)/16:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/18:2(9Z,12Z)/16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/18:2(9Z,12Z)/16:1(9Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/18:2(9Z,12Z)/16:1(9Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/18:2(9Z,12Z)/16:1(9Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:0/18:2(9Z,12Z)/18:0/16:0)
  • Cardiolipin Biosynthesis CL(16:0/18:2(9Z,12Z)/18:0/18:0)
  • Cardiolipin Biosynthesis CL(16:0/18:2(9Z,12Z)/18:0/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:0/18:2(9Z,12Z)/18:1(11Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/18:2(9Z,12Z)/18:1(11Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:0/18:2(9Z,12Z)/18:1(11Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/18:2(9Z,12Z)/18:1(11Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:0/18:2(9Z,12Z)/18:1(9Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/18:2(9Z,12Z)/18:1(9Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:0/18:2(9Z,12Z)/18:1(9Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/18:2(9Z,12Z)/18:1(9Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:0/18:2(9Z,12Z)/18:2(9Z,12Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/18:2(9Z,12Z)/18:2(9Z,12Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/18:2(9Z,12Z)/18:2(9Z,12Z)/18:0)
  • Cardiolipin Biosynthesis CL(16:0/18:2(9Z,12Z)/18:2(9Z,12Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:0/18:2(9Z,12Z)/18:2(9Z,12Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/18:2(9Z,12Z)/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:0/18:2(9Z,12Z)/18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:0/18:2(9Z,12Z)/18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:0/18:2(9Z,12Z)/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/18:2(9Z,12Z)/18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:0/18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:0/18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:0/18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:0/18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:0/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:0/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:0/18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/20:4(5Z,8Z,11Z,14Z)/16:0/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:0/20:4(5Z,8Z,11Z,14Z)/16:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:0/20:4(5Z,8Z,11Z,14Z)/16:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/20:4(5Z,8Z,11Z,14Z)/16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/20:4(5Z,8Z,11Z,14Z)/16:1(9Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/20:4(5Z,8Z,11Z,14Z)/16:1(9Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/20:4(5Z,8Z,11Z,14Z)/16:1(9Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:0/20:4(5Z,8Z,11Z,14Z)/18:0/16:0)
  • Cardiolipin Biosynthesis CL(16:0/20:4(5Z,8Z,11Z,14Z)/18:0/18:0)
  • Cardiolipin Biosynthesis CL(16:0/20:4(5Z,8Z,11Z,14Z)/18:0/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:0/20:4(5Z,8Z,11Z,14Z)/18:1(11Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/20:4(5Z,8Z,11Z,14Z)/18:1(11Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:0/20:4(5Z,8Z,11Z,14Z)/18:1(11Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/20:4(5Z,8Z,11Z,14Z)/18:1(11Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:0/20:4(5Z,8Z,11Z,14Z)/18:1(9Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/20:4(5Z,8Z,11Z,14Z)/18:1(9Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:0/20:4(5Z,8Z,11Z,14Z)/18:1(9Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/20:4(5Z,8Z,11Z,14Z)/18:1(9Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:0/20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:0/20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:0/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/18:0)
  • Cardiolipin Biosynthesis CL(16:0/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:0/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:0/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:0/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:0/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:0/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:0/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:0/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:0/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:0/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(4Z,7Z,10Z,13Z,16Z)/16:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(4Z,7Z,10Z,13Z,16Z)/16:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(4Z,7Z,10Z,13Z,16Z)/16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(4Z,7Z,10Z,13Z,16Z)/18:0/16:0)
  • Cardiolipin Biosynthesis CL(16:0/22:5(4Z,7Z,10Z,13Z,16Z)/18:0/18:0)
  • Cardiolipin Biosynthesis CL(16:0/22:5(4Z,7Z,10Z,13Z,16Z)/18:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(4Z,7Z,10Z,13Z,16Z)/18:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:0)
  • Cardiolipin Biosynthesis CL(16:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(16:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(7Z,10Z,13Z,16Z,19Z)/16:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(7Z,10Z,13Z,16Z,19Z)/16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(7Z,10Z,13Z,16Z,19Z)/16:1(9Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/22:5(7Z,10Z,13Z,16Z,19Z)/16:1(9Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(7Z,10Z,13Z,16Z,19Z)/16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(7Z,10Z,13Z,16Z,19Z)/16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(7Z,10Z,13Z,16Z,19Z)/18:0/16:0)
  • Cardiolipin Biosynthesis CL(16:0/22:5(7Z,10Z,13Z,16Z,19Z)/18:0/18:0)
  • Cardiolipin Biosynthesis CL(16:0/22:5(7Z,10Z,13Z,16Z,19Z)/18:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(7Z,10Z,13Z,16Z,19Z)/18:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:0)
  • Cardiolipin Biosynthesis CL(16:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(16:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:1(9Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:1(9Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:0/16:0)
  • Cardiolipin Biosynthesis CL(16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:0/18:0)
  • Cardiolipin Biosynthesis CL(16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:0/16:1(9Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:0/16:1(9Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:0/16:1(9Z)/18:0)
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:0/16:1(9Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:0/16:1(9Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:0/16:1(9Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:0/16:1(9Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:0/16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:0/16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:0/16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:0/18:1(11Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:0/18:1(11Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:0/18:1(11Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:0/18:1(11Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:0/18:1(9Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:0/18:1(9Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:0/18:1(9Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:0/18:1(9Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:0/18:2(9Z,12Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:0/18:2(9Z,12Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:0/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:0/20:4(5Z,8Z,11Z,14Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:0/20:4(5Z,8Z,11Z,14Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:0/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:0/22:5(4Z,7Z,10Z,13Z,16Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:0/22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:0/22:5(7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:0/22:5(7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/16:1(9Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/16:1(9Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/16:1(9Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/16:1(9Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/16:1(9Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/18:1(11Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/18:1(11Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/18:1(11Z)/18:0)
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/18:1(11Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/18:1(11Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/18:1(11Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/18:1(11Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/18:1(9Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/18:1(9Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/18:1(9Z)/18:0)
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/18:1(9Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/18:1(9Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/18:1(9Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/18:1(9Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/18:2(9Z,12Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/18:2(9Z,12Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/18:2(9Z,12Z)/18:0)
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/18:2(9Z,12Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/18:2(9Z,12Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/18:0)
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:0)
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:0/16:1(9Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:0/16:1(9Z)/18:0)
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:0/16:1(9Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:0/16:1(9Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:0/16:1(9Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:0/16:1(9Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:0/16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:0/16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:0/16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:0/18:1(11Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:0/18:1(11Z)/18:0)
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:0/18:1(11Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:0/18:1(11Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:0/18:1(9Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:0/18:1(9Z)/18:0)
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:0/18:1(9Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:0/18:1(9Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:0/18:2(9Z,12Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:0/18:2(9Z,12Z)/18:0)
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:0/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:0/20:4(5Z,8Z,11Z,14Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:0/20:4(5Z,8Z,11Z,14Z)/18:0)
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:0/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:0/22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:0/22:5(4Z,7Z,10Z,13Z,16Z)/18:0)
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:0/22:5(7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:0/22:5(7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(11Z)/16:1(9Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(11Z)/16:1(9Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(11Z)/16:1(9Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(11Z)/16:1(9Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(11Z)/16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(11Z)/16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(11Z)/16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(11Z)/18:1(11Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(11Z)/18:1(11Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(11Z)/18:1(11Z)/18:0)
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(11Z)/18:1(11Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(11Z)/18:1(11Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(11Z)/18:1(11Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(11Z)/18:1(11Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(11Z)/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(11Z)/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(11Z)/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(11Z)/18:1(9Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(11Z)/18:1(9Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(11Z)/18:1(9Z)/18:0)
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(11Z)/18:1(9Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(11Z)/18:1(9Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(11Z)/18:1(9Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(11Z)/18:1(9Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(11Z)/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(11Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(11Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(11Z)/18:2(9Z,12Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(11Z)/18:2(9Z,12Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(11Z)/18:2(9Z,12Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(11Z)/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(9Z)/16:1(9Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(9Z)/16:1(9Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(9Z)/16:1(9Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(9Z)/16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(9Z)/16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(9Z)/16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(9Z)/18:1(11Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(9Z)/18:1(11Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(9Z)/18:1(11Z)/18:0)
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(9Z)/18:1(11Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(9Z)/18:1(11Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(9Z)/18:1(11Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(9Z)/18:1(11Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(9Z)/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(9Z)/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(9Z)/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(9Z)/18:1(9Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(9Z)/18:1(9Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(9Z)/18:1(9Z)/18:0)
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(9Z)/18:1(9Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(9Z)/18:1(9Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(9Z)/18:1(9Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(9Z)/18:1(9Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(9Z)/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(9Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(9Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(9Z)/18:2(9Z,12Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(9Z)/18:2(9Z,12Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(9Z)/18:2(9Z,12Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(9Z)/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:2(9Z,12Z)/16:1(9Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:2(9Z,12Z)/16:1(9Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:2(9Z,12Z)/16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:2(9Z,12Z)/16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:2(9Z,12Z)/16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:2(9Z,12Z)/18:1(11Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:2(9Z,12Z)/18:1(11Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:2(9Z,12Z)/18:1(11Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:2(9Z,12Z)/18:1(11Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:2(9Z,12Z)/18:1(9Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:2(9Z,12Z)/18:1(9Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:2(9Z,12Z)/18:1(9Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:2(9Z,12Z)/18:1(9Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:2(9Z,12Z)/18:2(9Z,12Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:2(9Z,12Z)/18:2(9Z,12Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:2(9Z,12Z)/18:2(9Z,12Z)/18:0)
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:2(9Z,12Z)/18:2(9Z,12Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:2(9Z,12Z)/18:2(9Z,12Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:2(9Z,12Z)/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:2(9Z,12Z)/18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:2(9Z,12Z)/18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:2(9Z,12Z)/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:2(9Z,12Z)/18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/16:1(9Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/18:1(11Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/18:1(11Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/18:1(11Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/18:1(11Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/18:1(9Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/18:1(9Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/18:1(9Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/18:1(9Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/18:0)
  • Cardiolipin Biosynthesis CL(16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:0)
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:0)
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/16:0/16:1(9Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:0/16:0/16:1(9Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/16:0/16:1(9Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/16:0/18:0/16:0)
  • Cardiolipin Biosynthesis CL(18:0/16:0/18:0/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/16:0/18:0/18:0)
  • Cardiolipin Biosynthesis CL(18:0/16:0/18:0/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:0/16:0/18:0/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/16:0/18:0/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:0/16:0/18:0/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:0/16:0/18:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:0/16:0/18:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/16:0/18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/16:0/18:1(11Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:0/16:0/18:1(11Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/16:0/18:1(11Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:0/16:0/18:1(11Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/16:0/18:1(9Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:0/16:0/18:1(9Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/16:0/18:1(9Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:0/16:0/18:1(9Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/16:0/18:2(9Z,12Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:0/16:0/18:2(9Z,12Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/16:0/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:0/16:0/20:4(5Z,8Z,11Z,14Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:0/16:0/20:4(5Z,8Z,11Z,14Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/16:0/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:0/16:0/22:5(4Z,7Z,10Z,13Z,16Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:0/16:0/22:5(4Z,7Z,10Z,13Z,16Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/16:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:0/16:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/16:0/22:5(7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:0/16:0/22:5(7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/16:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:0/16:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:0/16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/16:1(9Z)/16:1(9Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:0/16:1(9Z)/16:1(9Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/16:1(9Z)/16:1(9Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/16:1(9Z)/16:1(9Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:0/16:1(9Z)/16:1(9Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/16:1(9Z)/16:1(9Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:0/16:1(9Z)/16:1(9Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:0/16:1(9Z)/16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:0/16:1(9Z)/16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/16:1(9Z)/16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/16:1(9Z)/18:0/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/16:1(9Z)/18:0/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:0/16:1(9Z)/18:0/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/16:1(9Z)/18:0/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:0/16:1(9Z)/18:0/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:0/16:1(9Z)/18:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:0/16:1(9Z)/18:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/16:1(9Z)/18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/16:1(9Z)/18:1(11Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/16:1(9Z)/18:1(11Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/16:1(9Z)/18:1(11Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:0/16:1(9Z)/18:1(11Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/16:1(9Z)/18:1(9Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/16:1(9Z)/18:1(9Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/16:1(9Z)/18:1(9Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:0/16:1(9Z)/18:1(9Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/16:1(9Z)/18:2(9Z,12Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/16:1(9Z)/18:2(9Z,12Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/16:1(9Z)/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:0/16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:0/16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:0/16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:0/16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/18:0/16:1(9Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:0/18:0/16:1(9Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/18:0/16:1(9Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/18:0/16:1(9Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:0/18:0/16:1(9Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/18:0/16:1(9Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:0/18:0/16:1(9Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:0/18:0/16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:0/18:0/16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/18:0/16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/18:0/18:0/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/18:0/18:0/18:0)
  • Cardiolipin Biosynthesis CL(18:0/18:0/18:0/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:0/18:0/18:0/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/18:0/18:0/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:0/18:0/18:0/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:0/18:0/18:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:0/18:0/18:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/18:0/18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/18:0/18:1(11Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:0/18:0/18:1(11Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/18:0/18:1(11Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/18:0/18:1(11Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:0/18:0/18:1(11Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/18:0/18:1(11Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:0/18:0/18:1(11Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:0/18:0/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:0/18:0/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/18:0/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/18:0/18:1(9Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:0/18:0/18:1(9Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/18:0/18:1(9Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/18:0/18:1(9Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:0/18:0/18:1(9Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/18:0/18:1(9Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:0/18:0/18:1(9Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:0/18:0/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:0/18:0/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/18:0/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/18:0/18:2(9Z,12Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:0/18:0/18:2(9Z,12Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/18:0/18:2(9Z,12Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/18:0/18:2(9Z,12Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:0/18:0/18:2(9Z,12Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/18:0/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:0/18:0/18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:0/18:0/18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:0/18:0/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/18:0/18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/18:0/20:4(5Z,8Z,11Z,14Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:0/18:0/20:4(5Z,8Z,11Z,14Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/18:0/20:4(5Z,8Z,11Z,14Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/18:0/20:4(5Z,8Z,11Z,14Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:0/18:0/20:4(5Z,8Z,11Z,14Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/18:0/20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:0/18:0/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:0/18:0/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:0/18:0/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/18:0/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/18:0/22:5(4Z,7Z,10Z,13Z,16Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:0/18:0/22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/18:0/22:5(4Z,7Z,10Z,13Z,16Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/18:0/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:0/18:0/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/18:0/22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:0/18:0/22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:0/18:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:0/18:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/18:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/18:0/22:5(7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:0/18:0/22:5(7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/18:0/22:5(7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/18:0/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:0/18:0/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/18:0/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:0/18:0/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:0/18:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:0/18:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/18:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:0/18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:0/18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:0/18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:0/18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:0/18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(11Z)/16:1(9Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(11Z)/16:1(9Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/18:1(11Z)/16:1(9Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(11Z)/16:1(9Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(11Z)/18:0/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(11Z)/18:0/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(11Z)/18:0/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(11Z)/18:0/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(11Z)/18:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(11Z)/18:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(11Z)/18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(11Z)/18:1(11Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:0/18:1(11Z)/18:1(11Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(11Z)/18:1(11Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/18:1(11Z)/18:1(11Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(11Z)/18:1(11Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(11Z)/18:1(11Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(11Z)/18:1(11Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(11Z)/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(11Z)/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(11Z)/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(11Z)/18:1(9Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:0/18:1(11Z)/18:1(9Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(11Z)/18:1(9Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/18:1(11Z)/18:1(9Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(11Z)/18:1(9Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(11Z)/18:1(9Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(11Z)/18:1(9Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(11Z)/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(11Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(11Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(11Z)/18:2(9Z,12Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/18:1(11Z)/18:2(9Z,12Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(11Z)/18:2(9Z,12Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(11Z)/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(9Z)/16:1(9Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(9Z)/16:1(9Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/18:1(9Z)/16:1(9Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(9Z)/16:1(9Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(9Z)/18:0/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(9Z)/18:0/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(9Z)/18:0/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(9Z)/18:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(9Z)/18:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(9Z)/18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(9Z)/18:1(11Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:0/18:1(9Z)/18:1(11Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(9Z)/18:1(11Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/18:1(9Z)/18:1(11Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(9Z)/18:1(11Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(9Z)/18:1(11Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(9Z)/18:1(11Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(9Z)/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(9Z)/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(9Z)/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(9Z)/18:1(9Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:0/18:1(9Z)/18:1(9Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(9Z)/18:1(9Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/18:1(9Z)/18:1(9Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(9Z)/18:1(9Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(9Z)/18:1(9Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(9Z)/18:1(9Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(9Z)/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(9Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(9Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(9Z)/18:2(9Z,12Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/18:1(9Z)/18:2(9Z,12Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(9Z)/18:2(9Z,12Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(9Z)/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/18:2(9Z,12Z)/16:1(9Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/18:2(9Z,12Z)/16:1(9Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/18:2(9Z,12Z)/16:1(9Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:0/18:2(9Z,12Z)/18:0/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:0/18:2(9Z,12Z)/18:0/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:0/18:2(9Z,12Z)/18:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:0/18:2(9Z,12Z)/18:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/18:2(9Z,12Z)/18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/18:2(9Z,12Z)/18:1(11Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/18:2(9Z,12Z)/18:1(11Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:0/18:2(9Z,12Z)/18:1(11Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/18:2(9Z,12Z)/18:1(11Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:0/18:2(9Z,12Z)/18:1(9Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/18:2(9Z,12Z)/18:1(9Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:0/18:2(9Z,12Z)/18:1(9Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/18:2(9Z,12Z)/18:1(9Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:0/18:2(9Z,12Z)/18:2(9Z,12Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:0/18:2(9Z,12Z)/18:2(9Z,12Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/18:2(9Z,12Z)/18:2(9Z,12Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/18:2(9Z,12Z)/18:2(9Z,12Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:0/18:2(9Z,12Z)/18:2(9Z,12Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/18:2(9Z,12Z)/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:0/18:2(9Z,12Z)/18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:0/18:2(9Z,12Z)/18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:0/18:2(9Z,12Z)/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/18:2(9Z,12Z)/18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:0/18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:0/18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:0/18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:0/18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:0/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:0/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:0/18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/20:4(5Z,8Z,11Z,14Z)/16:1(9Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/20:4(5Z,8Z,11Z,14Z)/16:1(9Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/20:4(5Z,8Z,11Z,14Z)/16:1(9Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:0/20:4(5Z,8Z,11Z,14Z)/18:0/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:0/20:4(5Z,8Z,11Z,14Z)/18:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:0/20:4(5Z,8Z,11Z,14Z)/18:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/20:4(5Z,8Z,11Z,14Z)/18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/20:4(5Z,8Z,11Z,14Z)/18:1(11Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/20:4(5Z,8Z,11Z,14Z)/18:1(11Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:0/20:4(5Z,8Z,11Z,14Z)/18:1(11Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/20:4(5Z,8Z,11Z,14Z)/18:1(11Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:0/20:4(5Z,8Z,11Z,14Z)/18:1(9Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/20:4(5Z,8Z,11Z,14Z)/18:1(9Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:0/20:4(5Z,8Z,11Z,14Z)/18:1(9Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/20:4(5Z,8Z,11Z,14Z)/18:1(9Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:0/20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:0/20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:0/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:0/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:0/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:0/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:0/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:0/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:0/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:0/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:0/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:0/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:0/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(4Z,7Z,10Z,13Z,16Z)/18:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(4Z,7Z,10Z,13Z,16Z)/18:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(4Z,7Z,10Z,13Z,16Z)/18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(7Z,10Z,13Z,16Z,19Z)/16:1(9Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(7Z,10Z,13Z,16Z,19Z)/16:1(9Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/22:5(7Z,10Z,13Z,16Z,19Z)/16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(7Z,10Z,13Z,16Z,19Z)/16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(7Z,10Z,13Z,16Z,19Z)/18:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(7Z,10Z,13Z,16Z,19Z)/18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:1(9Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:1(9Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:0/18:1(11Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:0/18:1(11Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:0/18:1(11Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:0/18:1(11Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:0/18:1(11Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:0/18:1(11Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:0/18:1(11Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:0/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:0/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:0/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:0/18:1(9Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:0/18:1(9Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:0/18:1(9Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:0/18:1(9Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:0/18:1(9Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:0/18:1(9Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:0/18:1(9Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:0/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:0/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:0/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:0/18:2(9Z,12Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:0/18:2(9Z,12Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:0/18:2(9Z,12Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:0/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:0/20:4(5Z,8Z,11Z,14Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:0/20:4(5Z,8Z,11Z,14Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:0/20:4(5Z,8Z,11Z,14Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:0/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:0/22:5(4Z,7Z,10Z,13Z,16Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:0/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:0/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:0/22:5(7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:0/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:0/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:1(9Z)/18:1(11Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:1(9Z)/18:1(11Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:1(9Z)/18:1(11Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:1(9Z)/18:1(11Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:1(9Z)/18:1(11Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:1(9Z)/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:1(9Z)/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:1(9Z)/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:1(9Z)/18:1(9Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:1(9Z)/18:1(9Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:1(9Z)/18:1(9Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:1(9Z)/18:1(9Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:1(9Z)/18:1(9Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:1(9Z)/18:1(9Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:1(9Z)/18:1(9Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:1(9Z)/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:1(9Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:1(9Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:1(9Z)/18:2(9Z,12Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:1(9Z)/18:2(9Z,12Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:1(9Z)/18:2(9Z,12Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:1(9Z)/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:0/18:1(11Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:0/18:1(11Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:0/18:1(11Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:0/18:1(11Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:0/18:1(11Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:0/18:1(11Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:0/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:0/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:0/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:0/18:1(9Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:0/18:1(9Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:0/18:1(9Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:0/18:1(9Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:0/18:1(9Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:0/18:1(9Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:0/18:1(9Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:0/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:0/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:0/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:0/18:2(9Z,12Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:0/18:2(9Z,12Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:0/18:2(9Z,12Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:0/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:0/20:4(5Z,8Z,11Z,14Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:0/20:4(5Z,8Z,11Z,14Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:0/20:4(5Z,8Z,11Z,14Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:0/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:0/22:5(4Z,7Z,10Z,13Z,16Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:0/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:0/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:0/22:5(7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:0/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:0/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(11Z)/18:1(11Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(11Z)/18:1(11Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(11Z)/18:1(11Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(11Z)/18:1(11Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(11Z)/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(11Z)/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(11Z)/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(11Z)/18:1(9Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(11Z)/18:1(9Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(11Z)/18:1(9Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(11Z)/18:1(9Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(11Z)/18:1(9Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(11Z)/18:1(9Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(11Z)/18:1(9Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(11Z)/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(11Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(11Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(11Z)/18:2(9Z,12Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(11Z)/18:2(9Z,12Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(11Z)/18:2(9Z,12Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(11Z)/18:2(9Z,12Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(11Z)/18:2(9Z,12Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(11Z)/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(11Z)/18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(11Z)/18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(11Z)/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(11Z)/18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(9Z)/18:1(11Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(9Z)/18:1(11Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(9Z)/18:1(11Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(9Z)/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(9Z)/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(9Z)/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(9Z)/18:1(9Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(9Z)/18:1(9Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(9Z)/18:1(9Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(9Z)/18:1(9Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(9Z)/18:1(9Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(9Z)/18:1(9Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(9Z)/18:1(9Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(9Z)/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(9Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(9Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(9Z)/18:2(9Z,12Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(9Z)/18:2(9Z,12Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(9Z)/18:2(9Z,12Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(9Z)/18:2(9Z,12Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(9Z)/18:2(9Z,12Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(9Z)/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(9Z)/18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(9Z)/18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(9Z)/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(9Z)/18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:2(9Z,12Z)/18:1(11Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:2(9Z,12Z)/18:1(11Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:2(9Z,12Z)/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:2(9Z,12Z)/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:2(9Z,12Z)/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:2(9Z,12Z)/18:1(9Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:2(9Z,12Z)/18:1(9Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:2(9Z,12Z)/18:1(9Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:2(9Z,12Z)/18:1(9Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:2(9Z,12Z)/18:1(9Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:2(9Z,12Z)/18:1(9Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:2(9Z,12Z)/18:1(9Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:2(9Z,12Z)/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:2(9Z,12Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:2(9Z,12Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:2(9Z,12Z)/18:2(9Z,12Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:2(9Z,12Z)/18:2(9Z,12Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:2(9Z,12Z)/18:2(9Z,12Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:2(9Z,12Z)/18:2(9Z,12Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:2(9Z,12Z)/18:2(9Z,12Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:2(9Z,12Z)/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:2(9Z,12Z)/18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:2(9Z,12Z)/18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:2(9Z,12Z)/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:2(9Z,12Z)/18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/18:1(11Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/18:1(9Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/18:1(9Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/18:1(9Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/18:1(9Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/18:1(9Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/18:1(9Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/18:1(9Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/16:0/18:1(9Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:1(9Z)/16:0/18:1(9Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/16:0/18:1(9Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:1(9Z)/16:0/18:1(9Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/16:0/18:1(9Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/16:0/18:1(9Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/16:0/18:1(9Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/16:0/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/16:0/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/16:0/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/16:0/18:2(9Z,12Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:1(9Z)/16:0/18:2(9Z,12Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/16:0/18:2(9Z,12Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/16:0/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/16:0/20:4(5Z,8Z,11Z,14Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:1(9Z)/16:0/20:4(5Z,8Z,11Z,14Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/16:0/20:4(5Z,8Z,11Z,14Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/16:0/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/16:0/22:5(4Z,7Z,10Z,13Z,16Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:1(9Z)/16:0/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/16:0/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/16:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/16:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/16:0/22:5(7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:1(9Z)/16:0/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/16:0/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/16:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/16:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:1(9Z)/16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/16:1(9Z)/18:1(9Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/16:1(9Z)/18:1(9Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/16:1(9Z)/18:1(9Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/16:1(9Z)/18:1(9Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/16:1(9Z)/18:1(9Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/16:1(9Z)/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/16:1(9Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/16:1(9Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/16:1(9Z)/18:2(9Z,12Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/16:1(9Z)/18:2(9Z,12Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/16:1(9Z)/18:2(9Z,12Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/16:1(9Z)/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:0/18:1(9Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:0/18:1(9Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:0/18:1(9Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:0/18:1(9Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:0/18:1(9Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:0/18:1(9Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:0/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:0/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:0/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:0/18:2(9Z,12Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:0/18:2(9Z,12Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:0/18:2(9Z,12Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:0/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:0/20:4(5Z,8Z,11Z,14Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:0/20:4(5Z,8Z,11Z,14Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:0/20:4(5Z,8Z,11Z,14Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:0/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:0/22:5(4Z,7Z,10Z,13Z,16Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:0/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:0/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:0/22:5(7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:0/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:0/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(11Z)/18:1(9Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(11Z)/18:1(9Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(11Z)/18:1(9Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(11Z)/18:1(9Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(11Z)/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(11Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(11Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(11Z)/18:2(9Z,12Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(11Z)/18:2(9Z,12Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(11Z)/18:2(9Z,12Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(11Z)/18:2(9Z,12Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(11Z)/18:2(9Z,12Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(11Z)/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(11Z)/18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(11Z)/18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(11Z)/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(11Z)/18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(9Z)/18:1(9Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(9Z)/18:1(9Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(9Z)/18:1(9Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(9Z)/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(9Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(9Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(9Z)/18:2(9Z,12Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(9Z)/18:2(9Z,12Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(9Z)/18:2(9Z,12Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(9Z)/18:2(9Z,12Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(9Z)/18:2(9Z,12Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(9Z)/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(9Z)/18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(9Z)/18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(9Z)/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(9Z)/18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:2(9Z,12Z)/18:1(9Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:2(9Z,12Z)/18:1(9Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:2(9Z,12Z)/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:2(9Z,12Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:2(9Z,12Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:2(9Z,12Z)/18:2(9Z,12Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:2(9Z,12Z)/18:2(9Z,12Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:2(9Z,12Z)/18:2(9Z,12Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:2(9Z,12Z)/18:2(9Z,12Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:2(9Z,12Z)/18:2(9Z,12Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:2(9Z,12Z)/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:2(9Z,12Z)/18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:2(9Z,12Z)/18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:2(9Z,12Z)/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:2(9Z,12Z)/18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/18:1(9Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/16:0/18:2(9Z,12Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/16:0/18:2(9Z,12Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/16:0/18:2(9Z,12Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/16:0/18:2(9Z,12Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/16:0/18:2(9Z,12Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/16:0/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/16:0/18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/16:0/18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/16:0/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/16:0/18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/16:0/20:4(5Z,8Z,11Z,14Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/16:0/20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/16:0/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/16:0/22:5(4Z,7Z,10Z,13Z,16Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/16:0/22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/16:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/16:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/16:0/22:5(7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/16:0/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/16:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/16:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/16:1(9Z)/18:2(9Z,12Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/16:1(9Z)/18:2(9Z,12Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/16:1(9Z)/18:2(9Z,12Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/16:1(9Z)/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/16:1(9Z)/18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/16:1(9Z)/18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/16:1(9Z)/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/16:1(9Z)/18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:0/18:2(9Z,12Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:0/18:2(9Z,12Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:0/18:2(9Z,12Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:0/18:2(9Z,12Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:0/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:0/18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:0/18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:0/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:0/18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:0/20:4(5Z,8Z,11Z,14Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:0/20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:0/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:0/22:5(4Z,7Z,10Z,13Z,16Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:0/22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:0/22:5(7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:0/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:1(11Z)/18:1(11Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:1(11Z)/18:1(11Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:1(11Z)/18:1(9Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:1(11Z)/18:1(9Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:1(11Z)/18:2(9Z,12Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:1(11Z)/18:2(9Z,12Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:1(11Z)/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:1(11Z)/18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:1(11Z)/18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:1(11Z)/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:1(11Z)/18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:1(9Z)/18:1(11Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:1(9Z)/18:1(11Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:1(9Z)/18:1(9Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:1(9Z)/18:1(9Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:1(9Z)/18:2(9Z,12Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:1(9Z)/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:1(9Z)/18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:1(9Z)/18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:1(9Z)/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:1(9Z)/18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:2(9Z,12Z)/18:1(11Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:2(9Z,12Z)/18:1(11Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:2(9Z,12Z)/18:1(11Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:2(9Z,12Z)/18:1(11Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:2(9Z,12Z)/18:1(9Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:2(9Z,12Z)/18:1(9Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:2(9Z,12Z)/18:1(9Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:2(9Z,12Z)/18:1(9Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:2(9Z,12Z)/18:2(9Z,12Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:2(9Z,12Z)/18:2(9Z,12Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:2(9Z,12Z)/18:2(9Z,12Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:2(9Z,12Z)/18:2(9Z,12Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:2(9Z,12Z)/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:2(9Z,12Z)/18:2(9Z,12Z)/18:3(6Z,9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:2(9Z,12Z)/18:2(9Z,12Z)/18:3(9Z,12Z,15Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:2(9Z,12Z)/18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:2(9Z,12Z)/18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:2(9Z,12Z)/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:2(9Z,12Z)/18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:2(9Z,12Z)/20:4(8Z,11Z,14Z,17Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/20:4(8Z,11Z,14Z,17Z)/20:4(8Z,11Z,14Z,17Z)/20:4(8Z,11Z,14Z,17Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(20:1(11Z)/18:2(9Z,12Z)/18:1(11Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(20:1(11Z)/18:2(9Z,12Z)/18:1(11Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(20:1(11Z)/18:2(9Z,12Z)/18:1(9Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(20:1(11Z)/18:2(9Z,12Z)/18:1(9Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(20:1(11Z)/18:2(9Z,12Z)/18:2(9Z,12Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(20:1(11Z)/18:2(9Z,12Z)/18:2(9Z,12Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(20:2(11Z,14Z)/18:2(9Z,12Z)/18:2(9Z,12Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(20:2(11Z,14Z)/18:2(9Z,12Z)/18:2(9Z,12Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(20:2(11Z,14Z)/18:2(9Z,12Z)/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(20:3(5Z,8Z,11Z)/18:2(9Z,12Z)/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(20:3(5Z,8Z,11Z)/20:3(5Z,8Z,11Z)/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(20:3(5Z,8Z,11Z)/20:3(8Z,11Z,14Z)/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(20:3(8Z,11Z,14Z)/18:2(9Z,12Z)/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(20:3(8Z,11Z,14Z)/20:3(5Z,8Z,11Z)/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(20:3(8Z,11Z,14Z)/20:3(8Z,11Z,14Z)/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/16:0/20:4(5Z,8Z,11Z,14Z)/16:0)
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/16:0/20:4(5Z,8Z,11Z,14Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/16:0/20:4(5Z,8Z,11Z,14Z)/18:0)
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/16:0/20:4(5Z,8Z,11Z,14Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/16:0/20:4(5Z,8Z,11Z,14Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/16:0/20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/16:0/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/16:0/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/16:0/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/16:0/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/16:0/22:5(4Z,7Z,10Z,13Z,16Z)/16:0)
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/16:0/22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/16:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/16:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/16:0/22:5(7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/16:0/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/16:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/16:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:0/20:4(5Z,8Z,11Z,14Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:0/20:4(5Z,8Z,11Z,14Z)/18:0)
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:0/20:4(5Z,8Z,11Z,14Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:0/20:4(5Z,8Z,11Z,14Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:0/20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:0/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:0/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:0/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:0/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:0/22:5(4Z,7Z,10Z,13Z,16Z)/18:0)
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:0/22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:0/22:5(7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:0/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z)/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/20:1(11Z)/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/20:2(11Z,14Z)/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/20:3(5Z,8Z,11Z)/18:2(9Z,12Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/20:3(5Z,8Z,11Z)/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/20:3(8Z,11Z,14Z)/18:2(9Z,12Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/20:3(8Z,11Z,14Z)/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/18:1(11Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/18:1(9Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z)/16:0)
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/16:0)
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:0)
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/20:4(8Z,11Z,14Z,17Z)/18:2(9Z,12Z)/16:0)
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/16:0)
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:0)
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/16:0)
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:0)
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(20:4(8Z,11Z,14Z,17Z)/18:2(9Z,12Z)/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(20:4(8Z,11Z,14Z,17Z)/20:1(11Z)/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(20:4(8Z,11Z,14Z,17Z)/20:2(11Z,14Z)/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(20:4(8Z,11Z,14Z,17Z)/20:3(5Z,8Z,11Z)/18:2(9Z,12Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(20:4(8Z,11Z,14Z,17Z)/20:3(5Z,8Z,11Z)/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(20:4(8Z,11Z,14Z,17Z)/20:3(8Z,11Z,14Z)/18:2(9Z,12Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(20:4(8Z,11Z,14Z,17Z)/20:3(8Z,11Z,14Z)/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(20:4(8Z,11Z,14Z,17Z)/20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z)/16:0)
  • Cardiolipin Biosynthesis CL(20:4(8Z,11Z,14Z,17Z)/20:4(8Z,11Z,14Z,17Z)/18:1(11Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(20:4(8Z,11Z,14Z,17Z)/20:4(8Z,11Z,14Z,17Z)/18:1(9Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(20:4(8Z,11Z,14Z,17Z)/20:4(8Z,11Z,14Z,17Z)/18:2(9Z,12Z)/16:0)
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/16:0/22:5(4Z,7Z,10Z,13Z,16Z)/16:0)
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/16:0/22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/16:0/22:5(4Z,7Z,10Z,13Z,16Z)/18:0)
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/16:0/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/16:0/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/16:0/22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/16:0/22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/16:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/16:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/16:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/16:0/22:5(7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/16:0/22:5(7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/16:0/22:5(7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/16:0/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/16:0/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/16:0/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/16:0/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/16:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/16:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/16:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:0/22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:0/22:5(4Z,7Z,10Z,13Z,16Z)/18:0)
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:0/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:0/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:0/22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:0/22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:0/22:5(7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:0/22:5(7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:0/22:5(7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:0/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:0/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:0/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:0/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z)/18:2(9Z,12Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z)/18:2(9Z,12Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/16:0/22:5(7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/16:0/22:5(7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/16:0/22:5(7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/16:0/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/16:0/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/16:0/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/16:0/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/16:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/16:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/16:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/18:0/22:5(7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/18:0/22:5(7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/18:0/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/18:0/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/18:0/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/18:0/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/18:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/18:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/18:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z)/18:2(9Z,12Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z)/18:2(9Z,12Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z)/18:1(11Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z)/18:1(11Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z)/18:1(11Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z)/18:1(9Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z)/18:1(9Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z)/18:1(9Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z)/18:2(9Z,12Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z)/18:2(9Z,12Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z)/18:2(9Z,12Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z)/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:2(11Z,14Z)/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:3(5Z,8Z,11Z)/18:2(9Z,12Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:3(5Z,8Z,11Z)/18:2(9Z,12Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:3(5Z,8Z,11Z)/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:3(8Z,11Z,14Z)/18:2(9Z,12Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:3(8Z,11Z,14Z)/18:2(9Z,12Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:3(8Z,11Z,14Z)/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z)/18:3(6Z,9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z)/18:3(9Z,12Z,15Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(8Z,11Z,14Z,17Z)/18:3(6Z,9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(8Z,11Z,14Z,17Z)/18:3(9Z,12Z,15Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis
  • De Novo Triacylglycerol Biosynthesis TG(10:0/10:0/10:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/10:0/12:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/10:0/13:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/10:0/14:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/10:0/15:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/10:0/16:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/10:0/17:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/10:0/18:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/10:0/19:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/10:0/8:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/10:0/a-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/10:0/a-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/10:0/a-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/10:0/a-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/10:0/a-25:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/10:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/10:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/10:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/10:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/10:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/10:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/10:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/10:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/10:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/10:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/10:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/10:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/12:0/12:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/12:0/13:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/12:0/14:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/12:0/15:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/12:0/a-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/12:0/a-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/12:0/a-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/12:0/a-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/12:0/a-25:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/12:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/12:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/12:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/12:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/12:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/12:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/12:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/12:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/12:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/12:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/12:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/12:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/13:0/13:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/13:0/15:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/13:0/16:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/13:0/8:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/13:0/a-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/13:0/a-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/13:0/a-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/13:0/a-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/13:0/a-25:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/13:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/13:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/13:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/13:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/13:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/13:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/13:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/13:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/13:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/13:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/13:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/13:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/14:0/13:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/14:0/14:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/14:0/15:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/14:0/17:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/14:0/18:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/14:0/19:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/14:0/a-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/14:0/a-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/14:0/a-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/14:0/a-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/14:0/a-25:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/14:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/14:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/14:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/14:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/14:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/14:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/14:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/14:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/14:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/14:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/14:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/14:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/15:0/15:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/15:0/17:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/15:0/18:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/15:0/8:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/15:0/a-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/15:0/a-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/15:0/a-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/15:0/a-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/15:0/a-25:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/15:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/15:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/15:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/15:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/15:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/15:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/15:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/15:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/15:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/15:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/15:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/15:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/16:0/12:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/16:0/14:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/16:0/15:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/16:0/16:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/16:0/17:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/16:0/18:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/16:0/8:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/16:0/a-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/16:0/a-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/16:0/a-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/16:0/a-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/16:0/a-25:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/16:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/16:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/16:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/16:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/16:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/16:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/16:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/16:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/16:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/16:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/16:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/16:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/17:0/12:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/17:0/13:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/17:0/17:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/17:0/a-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/17:0/a-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/17:0/a-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/17:0/a-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/17:0/a-25:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/17:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/17:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/17:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/17:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/17:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/17:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/17:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/17:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/17:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/17:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/17:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/17:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/18:0/12:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/18:0/13:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/18:0/17:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/18:0/18:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/18:0/19:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/18:0/8:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/18:0/a-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/18:0/a-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/18:0/a-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/18:0/a-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/18:0/a-25:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/18:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/18:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/18:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/18:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/18:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/18:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/18:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/18:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/18:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/18:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/18:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/18:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/19:0/12:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/19:0/13:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/19:0/15:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/19:0/16:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/19:0/17:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/19:0/19:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/19:0/a-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/19:0/a-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/19:0/a-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/19:0/a-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/19:0/a-25:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/19:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/19:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/19:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/19:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/19:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/19:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/19:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/19:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/19:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/19:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/19:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/19:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/20:0/a-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/20:0/a-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/20:0/a-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/20:0/a-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/20:0/a-25:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/20:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/20:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/20:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/20:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/20:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/20:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/20:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/20:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/20:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/20:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/20:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/20:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/21:0/a-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/21:0/a-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/21:0/a-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/21:0/a-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/21:0/a-25:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/21:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/21:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/21:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/21:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/21:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/21:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/21:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/21:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/21:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/21:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/21:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/21:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/22:0/a-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/22:0/a-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/22:0/a-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/22:0/a-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/22:0/a-25:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/22:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/22:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/22:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/22:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/22:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/22:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/22:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/22:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/22:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/22:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/22:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/22:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/8:0/17:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/8:0/8:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/8:0/a-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/8:0/a-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/8:0/a-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/8:0/a-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/8:0/a-25:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/8:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/8:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/8:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/8:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/8:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/8:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/8:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/8:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/8:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/8:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/8:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/8:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/a-13:0/a-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/a-13:0/a-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/a-13:0/a-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/a-13:0/a-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/a-13:0/a-25:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/a-13:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/a-13:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/a-13:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/a-13:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/a-13:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/a-13:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/a-13:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/a-13:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/a-13:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/a-13:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/a-13:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/a-13:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/a-15:0/a-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/a-15:0/a-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/a-15:0/a-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/a-15:0/a-25:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/a-15:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/a-15:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/a-15:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/a-15:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/a-15:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/a-15:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/a-15:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/a-15:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/a-15:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/a-15:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/a-15:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/a-15:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/a-17:0/a-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/a-17:0/a-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/a-17:0/a-25:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/a-17:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/a-17:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/a-17:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/a-17:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/a-17:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/a-17:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/a-17:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/a-17:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/a-17:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/a-17:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/a-17:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/a-17:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/a-21:0/a-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/a-21:0/a-25:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/a-21:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/a-21:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/a-21:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/a-21:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/a-21:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/a-21:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/a-21:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/a-21:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/a-21:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/a-21:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/a-21:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/a-21:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/a-25:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/a-25:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/a-25:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/a-25:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/a-25:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/a-25:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/a-25:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/a-25:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/a-25:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/i-12:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/i-12:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/i-12:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/i-12:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/i-12:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/i-12:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/i-12:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/i-12:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/i-12:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/i-12:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/i-12:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/i-12:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/i-13:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/i-13:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/i-13:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/i-13:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/i-13:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/i-13:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/i-13:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/i-13:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/i-13:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/i-13:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/i-13:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/i-14:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/i-14:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/i-14:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/i-14:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/i-14:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/i-14:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/i-14:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/i-14:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/i-14:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/i-14:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/i-15:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/i-15:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/i-15:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/i-15:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/i-15:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/i-15:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/i-15:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/i-15:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/i-15:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/i-16:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/i-16:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/i-16:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/i-16:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/i-16:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/i-16:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/i-16:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/i-16:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/i-17:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/i-17:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/i-17:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/i-17:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/i-17:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/i-17:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/i-17:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/i-18:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/i-18:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/i-18:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/i-18:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/i-18:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/i-18:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/i-19:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/i-19:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/i-19:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/i-19:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/i-19:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/i-20:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/i-20:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/i-20:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/i-20:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/i-21:0/a-25:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/i-21:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/i-21:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/i-21:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/i-22:0/a-25:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/i-22:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/i-22:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/i-24:0/a-25:0)
  • De Novo Triacylglycerol Biosynthesis TG(10:0/i-24:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(12:0/12:0/12:0)
  • De Novo Triacylglycerol Biosynthesis TG(14:0/14:0/14:0)
  • De Novo Triacylglycerol Biosynthesis TG(14:0/14:0/14:1(9Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/14:0/15:0)
  • De Novo Triacylglycerol Biosynthesis TG(14:0/14:0/16:0)
  • De Novo Triacylglycerol Biosynthesis TG(14:0/14:0/16:1(9Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/14:0/18:0)
  • De Novo Triacylglycerol Biosynthesis TG(14:0/14:0/18:1(11Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/14:0/18:1(9Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/14:0/18:2(9Z,12Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/14:0/18:3(6Z,9Z,12Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/14:0/18:3(9Z,12Z,15Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/14:0/18:4(6Z,9Z,12Z,15Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/14:0/20:0)
  • De Novo Triacylglycerol Biosynthesis TG(14:0/14:0/20:1(11Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/14:0/20:2(11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/14:0/20:3(5Z,8Z,11Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/14:0/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/14:0/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/14:0/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/14:0/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/14:0/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(14:0/14:0/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/14:0/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/14:0/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/14:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/14:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/14:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/14:0/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(14:0/14:0/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/14:1(9Z)/14:1(9Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/14:1(9Z)/15:0)
  • De Novo Triacylglycerol Biosynthesis TG(14:0/14:1(9Z)/16:0)
  • De Novo Triacylglycerol Biosynthesis TG(14:0/14:1(9Z)/16:1(9Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/14:1(9Z)/18:0)
  • De Novo Triacylglycerol Biosynthesis TG(14:0/14:1(9Z)/18:1(11Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/14:1(9Z)/18:1(9Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/14:1(9Z)/18:2(9Z,12Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/14:1(9Z)/18:3(6Z,9Z,12Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/14:1(9Z)/18:3(9Z,12Z,15Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/14:1(9Z)/18:4(6Z,9Z,12Z,15Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/14:1(9Z)/20:0)
  • De Novo Triacylglycerol Biosynthesis TG(14:0/14:1(9Z)/20:1(11Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/14:1(9Z)/20:2(11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/14:1(9Z)/20:3(5Z,8Z,11Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/14:1(9Z)/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/14:1(9Z)/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/14:1(9Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/14:1(9Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/14:1(9Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(14:0/14:1(9Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/14:1(9Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/14:1(9Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/14:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/14:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/14:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/14:1(9Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(14:0/14:1(9Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/15:0/15:0)
  • De Novo Triacylglycerol Biosynthesis TG(14:0/15:0/16:0)
  • De Novo Triacylglycerol Biosynthesis TG(14:0/15:0/16:1(9Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/15:0/18:0)
  • De Novo Triacylglycerol Biosynthesis TG(14:0/15:0/18:1(11Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/15:0/18:1(9Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/15:0/18:2(9Z,12Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/15:0/18:3(6Z,9Z,12Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/15:0/18:3(9Z,12Z,15Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/15:0/18:4(6Z,9Z,12Z,15Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/15:0/20:0)
  • De Novo Triacylglycerol Biosynthesis TG(14:0/15:0/20:1(11Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/15:0/20:2(11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/15:0/20:3(5Z,8Z,11Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/15:0/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/15:0/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/15:0/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/15:0/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/15:0/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(14:0/15:0/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/15:0/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/15:0/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/15:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/15:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/15:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/15:0/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(14:0/15:0/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/16:0/16:0)
  • De Novo Triacylglycerol Biosynthesis TG(14:0/16:0/16:1(9Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/16:0/18:0)
  • De Novo Triacylglycerol Biosynthesis TG(14:0/16:0/18:1(11Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/16:0/18:1(9Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/16:0/18:2(9Z,12Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/16:0/18:3(6Z,9Z,12Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/16:0/18:3(9Z,12Z,15Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/16:0/18:4(6Z,9Z,12Z,15Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/16:0/20:0)
  • De Novo Triacylglycerol Biosynthesis TG(14:0/16:0/20:1(11Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/16:0/20:2(11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/16:0/20:3(5Z,8Z,11Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/16:0/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/16:0/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/16:0/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/16:0/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/16:0/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(14:0/16:0/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/16:0/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/16:0/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/16:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/16:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/16:0/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(14:0/16:0/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/16:1(9Z)/16:1(9Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/16:1(9Z)/18:0)
  • De Novo Triacylglycerol Biosynthesis TG(14:0/16:1(9Z)/18:1(11Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/16:1(9Z)/18:1(9Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/16:1(9Z)/18:2(9Z,12Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/16:1(9Z)/18:3(6Z,9Z,12Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/16:1(9Z)/18:3(9Z,12Z,15Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/16:1(9Z)/18:4(6Z,9Z,12Z,15Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/16:1(9Z)/20:0)
  • De Novo Triacylglycerol Biosynthesis TG(14:0/16:1(9Z)/20:1(11Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/16:1(9Z)/20:2(11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/16:1(9Z)/20:3(5Z,8Z,11Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/16:1(9Z)/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/16:1(9Z)/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/16:1(9Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/16:1(9Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/16:1(9Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(14:0/16:1(9Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/16:1(9Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/16:1(9Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/16:1(9Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(14:0/16:1(9Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/18:0/18:0)
  • De Novo Triacylglycerol Biosynthesis TG(14:0/18:0/18:1(11Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/18:0/18:1(9Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/18:0/18:2(9Z,12Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/18:0/18:3(6Z,9Z,12Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/18:0/18:3(9Z,12Z,15Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/18:0/18:4(6Z,9Z,12Z,15Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/18:0/20:0)
  • De Novo Triacylglycerol Biosynthesis TG(14:0/18:0/20:1(11Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/18:0/20:2(11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/18:0/20:3(5Z,8Z,11Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/18:0/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/18:0/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/18:0/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/18:0/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/18:0/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(14:0/18:0/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/18:0/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/18:0/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/18:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/18:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/18:0/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(14:0/18:0/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/18:1(11Z)/18:1(11Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/18:1(11Z)/18:1(9Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/18:1(11Z)/18:2(9Z,12Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/18:1(11Z)/18:3(6Z,9Z,12Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/18:1(11Z)/18:3(9Z,12Z,15Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/18:1(11Z)/18:4(6Z,9Z,12Z,15Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/18:1(11Z)/20:0)
  • De Novo Triacylglycerol Biosynthesis TG(14:0/18:1(11Z)/20:1(11Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/18:1(11Z)/20:2(11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/18:1(11Z)/20:3(5Z,8Z,11Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/18:1(11Z)/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/18:1(11Z)/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/18:1(11Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/18:1(11Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/18:1(11Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(14:0/18:1(11Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/18:1(11Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/18:1(11Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/18:1(11Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(14:0/18:1(11Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/18:1(9Z)/18:1(9Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/18:1(9Z)/18:2(9Z,12Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/18:1(9Z)/18:3(6Z,9Z,12Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/18:1(9Z)/18:3(9Z,12Z,15Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/18:1(9Z)/18:4(6Z,9Z,12Z,15Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/18:1(9Z)/20:0)
  • De Novo Triacylglycerol Biosynthesis TG(14:0/18:1(9Z)/20:1(11Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/18:1(9Z)/20:2(11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/18:1(9Z)/20:3(5Z,8Z,11Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/18:1(9Z)/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/18:1(9Z)/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/18:1(9Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/18:1(9Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/18:1(9Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(14:0/18:1(9Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/18:1(9Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/18:1(9Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/18:1(9Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(14:0/18:1(9Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/18:2(9Z,12Z)/18:2(9Z,12Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/18:2(9Z,12Z)/18:3(6Z,9Z,12Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/18:2(9Z,12Z)/18:3(9Z,12Z,15Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/18:2(9Z,12Z)/18:4(6Z,9Z,12Z,15Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/18:2(9Z,12Z)/20:0)
  • De Novo Triacylglycerol Biosynthesis TG(14:0/18:2(9Z,12Z)/20:1(11Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/18:2(9Z,12Z)/20:2(11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/18:2(9Z,12Z)/20:3(5Z,8Z,11Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/18:2(9Z,12Z)/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/18:2(9Z,12Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/18:2(9Z,12Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/18:2(9Z,12Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(14:0/18:2(9Z,12Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/18:2(9Z,12Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/18:2(9Z,12Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/18:2(9Z,12Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(14:0/18:2(9Z,12Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/18:3(6Z,9Z,12Z)/18:3(6Z,9Z,12Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/18:3(6Z,9Z,12Z)/18:3(9Z,12Z,15Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/18:3(6Z,9Z,12Z)/18:4(6Z,9Z,12Z,15Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/18:3(6Z,9Z,12Z)/20:0)
  • De Novo Triacylglycerol Biosynthesis TG(14:0/18:3(6Z,9Z,12Z)/20:1(11Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/18:3(6Z,9Z,12Z)/20:2(11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/18:3(6Z,9Z,12Z)/20:3(5Z,8Z,11Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/18:3(6Z,9Z,12Z)/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/18:3(6Z,9Z,12Z)/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/18:3(6Z,9Z,12Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/18:3(6Z,9Z,12Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/18:3(6Z,9Z,12Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(14:0/18:3(6Z,9Z,12Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/18:3(6Z,9Z,12Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/18:3(6Z,9Z,12Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/18:3(6Z,9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/18:3(6Z,9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/18:3(6Z,9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/18:3(6Z,9Z,12Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(14:0/18:3(6Z,9Z,12Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/18:3(9Z,12Z,15Z)/18:3(9Z,12Z,15Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/18:3(9Z,12Z,15Z)/18:4(6Z,9Z,12Z,15Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/18:3(9Z,12Z,15Z)/20:0)
  • De Novo Triacylglycerol Biosynthesis TG(14:0/18:3(9Z,12Z,15Z)/20:1(11Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/18:3(9Z,12Z,15Z)/20:2(11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/18:3(9Z,12Z,15Z)/20:3(5Z,8Z,11Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/18:3(9Z,12Z,15Z)/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/18:3(9Z,12Z,15Z)/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/18:3(9Z,12Z,15Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/18:3(9Z,12Z,15Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/18:3(9Z,12Z,15Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(14:0/18:3(9Z,12Z,15Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/18:3(9Z,12Z,15Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/18:3(9Z,12Z,15Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/18:3(9Z,12Z,15Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/18:3(9Z,12Z,15Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/18:3(9Z,12Z,15Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/18:3(9Z,12Z,15Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(14:0/18:3(9Z,12Z,15Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/18:4(6Z,9Z,12Z,15Z)/18:4(6Z,9Z,12Z,15Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/18:4(6Z,9Z,12Z,15Z)/20:0)
  • De Novo Triacylglycerol Biosynthesis TG(14:0/18:4(6Z,9Z,12Z,15Z)/20:1(11Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/18:4(6Z,9Z,12Z,15Z)/20:2(11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/18:4(6Z,9Z,12Z,15Z)/20:3(5Z,8Z,11Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/18:4(6Z,9Z,12Z,15Z)/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/18:4(6Z,9Z,12Z,15Z)/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/18:4(6Z,9Z,12Z,15Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/18:4(6Z,9Z,12Z,15Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/18:4(6Z,9Z,12Z,15Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(14:0/18:4(6Z,9Z,12Z,15Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/18:4(6Z,9Z,12Z,15Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/18:4(6Z,9Z,12Z,15Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/18:4(6Z,9Z,12Z,15Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/18:4(6Z,9Z,12Z,15Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/18:4(6Z,9Z,12Z,15Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/18:4(6Z,9Z,12Z,15Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(14:0/18:4(6Z,9Z,12Z,15Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/20:0/20:0)
  • De Novo Triacylglycerol Biosynthesis TG(14:0/20:0/20:1(11Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/20:0/20:2(11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/20:0/20:3(5Z,8Z,11Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/20:0/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/20:0/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/20:0/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/20:0/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/20:0/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(14:0/20:0/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/20:0/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/20:0/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/20:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/20:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/20:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/20:0/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(14:0/20:0/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/20:1(11Z)/20:1(11Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/20:1(11Z)/20:2(11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/20:1(11Z)/20:3(5Z,8Z,11Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/20:1(11Z)/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/20:1(11Z)/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/20:1(11Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/20:1(11Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/20:1(11Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(14:0/20:1(11Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/20:1(11Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/20:1(11Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/20:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/20:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/20:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/20:1(11Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(14:0/20:1(11Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/20:2(11Z,14Z)/20:2(11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/20:2(11Z,14Z)/20:3(5Z,8Z,11Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/20:2(11Z,14Z)/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/20:2(11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/20:2(11Z,14Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/20:2(11Z,14Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/20:2(11Z,14Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(14:0/20:2(11Z,14Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/20:2(11Z,14Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/20:2(11Z,14Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/20:2(11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/20:2(11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/20:2(11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/20:2(11Z,14Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(14:0/20:2(11Z,14Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/20:3(5Z,8Z,11Z)/20:3(5Z,8Z,11Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/20:3(5Z,8Z,11Z)/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/20:3(5Z,8Z,11Z)/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/20:3(5Z,8Z,11Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/20:3(5Z,8Z,11Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/20:3(5Z,8Z,11Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(14:0/20:3(5Z,8Z,11Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/20:3(5Z,8Z,11Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/20:3(5Z,8Z,11Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/20:3(5Z,8Z,11Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/20:3(5Z,8Z,11Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/20:3(5Z,8Z,11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/20:3(5Z,8Z,11Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(14:0/20:3(5Z,8Z,11Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/20:3(8Z,11Z,14Z)/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/20:3(8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/20:3(8Z,11Z,14Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/20:3(8Z,11Z,14Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/20:3(8Z,11Z,14Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(14:0/20:3(8Z,11Z,14Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/20:3(8Z,11Z,14Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/20:3(8Z,11Z,14Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/20:3(8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/20:3(8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/20:3(8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/20:3(8Z,11Z,14Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(14:0/20:3(8Z,11Z,14Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/20:4(5Z,8Z,11Z,14Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/20:4(5Z,8Z,11Z,14Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/20:4(5Z,8Z,11Z,14Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(14:0/20:4(5Z,8Z,11Z,14Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/20:4(5Z,8Z,11Z,14Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/20:4(5Z,8Z,11Z,14Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/20:4(5Z,8Z,11Z,14Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(14:0/20:4(5Z,8Z,11Z,14Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/20:4(8Z,11Z,14Z,17Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/20:4(8Z,11Z,14Z,17Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/20:4(8Z,11Z,14Z,17Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(14:0/20:4(8Z,11Z,14Z,17Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/20:4(8Z,11Z,14Z,17Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/20:4(8Z,11Z,14Z,17Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/20:4(8Z,11Z,14Z,17Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/20:4(8Z,11Z,14Z,17Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/20:4(8Z,11Z,14Z,17Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/20:4(8Z,11Z,14Z,17Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(14:0/20:4(8Z,11Z,14Z,17Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/20:5(5Z,8Z,11Z,14Z,17Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/20:5(5Z,8Z,11Z,14Z,17Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(14:0/20:5(5Z,8Z,11Z,14Z,17Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/20:5(5Z,8Z,11Z,14Z,17Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/20:5(5Z,8Z,11Z,14Z,17Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/20:5(5Z,8Z,11Z,14Z,17Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/20:5(5Z,8Z,11Z,14Z,17Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/20:5(5Z,8Z,11Z,14Z,17Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/20:5(5Z,8Z,11Z,14Z,17Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(14:0/20:5(5Z,8Z,11Z,14Z,17Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/22:0/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(14:0/22:0/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/22:0/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/22:0/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/22:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/22:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/22:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/22:0/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(14:0/22:0/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/22:1(13Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/22:1(13Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/22:1(13Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/22:1(13Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/22:1(13Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/22:1(13Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/22:1(13Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(14:0/22:1(13Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/22:2(13Z,16Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/22:2(13Z,16Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/22:2(13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/22:2(13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/22:2(13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/22:2(13Z,16Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(14:0/22:2(13Z,16Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/22:4(7Z,10Z,13Z,16Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/22:4(7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/22:4(7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/22:4(7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/22:4(7Z,10Z,13Z,16Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(14:0/22:4(7Z,10Z,13Z,16Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/22:5(4Z,7Z,10Z,13Z,16Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(14:0/22:5(4Z,7Z,10Z,13Z,16Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/22:5(7Z,10Z,13Z,16Z,19Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(14:0/22:5(7Z,10Z,13Z,16Z,19Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(14:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/24:0/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(14:0/24:0/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:0/24:1(15Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/14:1(9Z)/14:1(9Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/14:1(9Z)/15:0)
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/14:1(9Z)/16:0)
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/14:1(9Z)/16:1(9Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/14:1(9Z)/18:0)
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/14:1(9Z)/18:1(11Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/14:1(9Z)/18:1(9Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/14:1(9Z)/18:2(9Z,12Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/14:1(9Z)/18:3(6Z,9Z,12Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/14:1(9Z)/18:3(9Z,12Z,15Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/14:1(9Z)/18:4(6Z,9Z,12Z,15Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/14:1(9Z)/20:0)
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/14:1(9Z)/20:1(11Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/14:1(9Z)/20:2(11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/14:1(9Z)/20:3(5Z,8Z,11Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/14:1(9Z)/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/14:1(9Z)/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/14:1(9Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/14:1(9Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/14:1(9Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/14:1(9Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/14:1(9Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/14:1(9Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/14:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/14:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/14:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/14:1(9Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/14:1(9Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/15:0/15:0)
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/15:0/16:0)
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/15:0/16:1(9Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/15:0/18:0)
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/15:0/18:1(11Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/15:0/18:1(9Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/15:0/18:2(9Z,12Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/15:0/18:3(6Z,9Z,12Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/15:0/18:3(9Z,12Z,15Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/15:0/18:4(6Z,9Z,12Z,15Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/15:0/20:0)
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/15:0/20:1(11Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/15:0/20:2(11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/15:0/20:3(5Z,8Z,11Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/15:0/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/15:0/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/15:0/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/15:0/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/15:0/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/15:0/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/15:0/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/15:0/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/15:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/15:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/15:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/15:0/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/15:0/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/16:0/16:0)
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/16:0/16:1(9Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/16:0/18:0)
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/16:0/18:1(11Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/16:0/18:1(9Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/16:0/18:2(9Z,12Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/16:0/18:3(6Z,9Z,12Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/16:0/18:3(9Z,12Z,15Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/16:0/18:4(6Z,9Z,12Z,15Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/16:0/20:0)
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/16:0/20:1(11Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/16:0/20:2(11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/16:0/20:3(5Z,8Z,11Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/16:0/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/16:0/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/16:0/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/16:0/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/16:0/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/16:0/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/16:0/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/16:0/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/16:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/16:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/16:0/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/16:0/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/16:1(9Z)/16:1(9Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/16:1(9Z)/18:0)
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/16:1(9Z)/18:1(11Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/16:1(9Z)/18:1(9Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/16:1(9Z)/18:2(9Z,12Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/16:1(9Z)/18:3(6Z,9Z,12Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/16:1(9Z)/18:3(9Z,12Z,15Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/16:1(9Z)/18:4(6Z,9Z,12Z,15Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/16:1(9Z)/20:0)
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/16:1(9Z)/20:1(11Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/16:1(9Z)/20:2(11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/16:1(9Z)/20:3(5Z,8Z,11Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/16:1(9Z)/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/16:1(9Z)/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/16:1(9Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/16:1(9Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/16:1(9Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/16:1(9Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/16:1(9Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/16:1(9Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/16:1(9Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/16:1(9Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/18:0/18:0)
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/18:0/18:1(11Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/18:0/18:1(9Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/18:0/18:2(9Z,12Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/18:0/18:3(6Z,9Z,12Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/18:0/18:3(9Z,12Z,15Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/18:0/18:4(6Z,9Z,12Z,15Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/18:0/20:0)
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/18:0/20:1(11Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/18:0/20:2(11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/18:0/20:3(5Z,8Z,11Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/18:0/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/18:0/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/18:0/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/18:0/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/18:0/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/18:0/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/18:0/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/18:0/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/18:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/18:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/18:0/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/18:0/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/18:1(11Z)/18:1(11Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/18:1(11Z)/18:1(9Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/18:1(11Z)/18:2(9Z,12Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/18:1(11Z)/18:3(6Z,9Z,12Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/18:1(11Z)/18:3(9Z,12Z,15Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/18:1(11Z)/18:4(6Z,9Z,12Z,15Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/18:1(11Z)/20:0)
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/18:1(11Z)/20:1(11Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/18:1(11Z)/20:2(11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/18:1(11Z)/20:3(5Z,8Z,11Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/18:1(11Z)/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/18:1(11Z)/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/18:1(11Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/18:1(11Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/18:1(11Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/18:1(11Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/18:1(11Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/18:1(11Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/18:1(11Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/18:1(11Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/18:1(9Z)/18:1(9Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/18:1(9Z)/18:2(9Z,12Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/18:1(9Z)/18:3(6Z,9Z,12Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/18:1(9Z)/18:3(9Z,12Z,15Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/18:1(9Z)/18:4(6Z,9Z,12Z,15Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/18:1(9Z)/20:0)
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/18:1(9Z)/20:1(11Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/18:1(9Z)/20:2(11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/18:1(9Z)/20:3(5Z,8Z,11Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/18:1(9Z)/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/18:1(9Z)/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/18:1(9Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/18:1(9Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/18:1(9Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/18:1(9Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/18:1(9Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/18:1(9Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/18:1(9Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/18:1(9Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/18:2(9Z,12Z)/18:2(9Z,12Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/18:2(9Z,12Z)/18:3(6Z,9Z,12Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/18:2(9Z,12Z)/18:3(9Z,12Z,15Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/18:2(9Z,12Z)/18:4(6Z,9Z,12Z,15Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/18:2(9Z,12Z)/20:0)
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/18:2(9Z,12Z)/20:1(11Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/18:2(9Z,12Z)/20:2(11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/18:2(9Z,12Z)/20:3(5Z,8Z,11Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/18:2(9Z,12Z)/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/18:2(9Z,12Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/18:2(9Z,12Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/18:2(9Z,12Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/18:2(9Z,12Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/18:2(9Z,12Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/18:2(9Z,12Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/18:2(9Z,12Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/18:2(9Z,12Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/18:3(6Z,9Z,12Z)/18:3(6Z,9Z,12Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/18:3(6Z,9Z,12Z)/18:3(9Z,12Z,15Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/18:3(6Z,9Z,12Z)/18:4(6Z,9Z,12Z,15Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/18:3(6Z,9Z,12Z)/20:0)
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/18:3(6Z,9Z,12Z)/20:1(11Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/18:3(6Z,9Z,12Z)/20:2(11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/18:3(6Z,9Z,12Z)/20:3(5Z,8Z,11Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/18:3(6Z,9Z,12Z)/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/18:3(6Z,9Z,12Z)/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/18:3(6Z,9Z,12Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/18:3(6Z,9Z,12Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/18:3(6Z,9Z,12Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/18:3(6Z,9Z,12Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/18:3(6Z,9Z,12Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/18:3(6Z,9Z,12Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/18:3(6Z,9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/18:3(6Z,9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/18:3(6Z,9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/18:3(6Z,9Z,12Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/18:3(6Z,9Z,12Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/18:3(9Z,12Z,15Z)/18:3(9Z,12Z,15Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/18:3(9Z,12Z,15Z)/18:4(6Z,9Z,12Z,15Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/18:3(9Z,12Z,15Z)/20:0)
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/18:3(9Z,12Z,15Z)/20:1(11Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/18:3(9Z,12Z,15Z)/20:2(11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/18:3(9Z,12Z,15Z)/20:3(5Z,8Z,11Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/18:3(9Z,12Z,15Z)/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/18:3(9Z,12Z,15Z)/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/18:3(9Z,12Z,15Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/18:3(9Z,12Z,15Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/18:3(9Z,12Z,15Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/18:3(9Z,12Z,15Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/18:3(9Z,12Z,15Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/18:3(9Z,12Z,15Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/18:3(9Z,12Z,15Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/18:3(9Z,12Z,15Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/18:3(9Z,12Z,15Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/18:3(9Z,12Z,15Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/18:3(9Z,12Z,15Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/18:4(6Z,9Z,12Z,15Z)/18:4(6Z,9Z,12Z,15Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/18:4(6Z,9Z,12Z,15Z)/20:0)
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/18:4(6Z,9Z,12Z,15Z)/20:1(11Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/18:4(6Z,9Z,12Z,15Z)/20:2(11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/18:4(6Z,9Z,12Z,15Z)/20:3(5Z,8Z,11Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/18:4(6Z,9Z,12Z,15Z)/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/18:4(6Z,9Z,12Z,15Z)/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/18:4(6Z,9Z,12Z,15Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/18:4(6Z,9Z,12Z,15Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/18:4(6Z,9Z,12Z,15Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/18:4(6Z,9Z,12Z,15Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/18:4(6Z,9Z,12Z,15Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/18:4(6Z,9Z,12Z,15Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/18:4(6Z,9Z,12Z,15Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/18:4(6Z,9Z,12Z,15Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/18:4(6Z,9Z,12Z,15Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/18:4(6Z,9Z,12Z,15Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/18:4(6Z,9Z,12Z,15Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/20:0/20:0)
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/20:0/20:1(11Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/20:0/20:2(11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/20:0/20:3(5Z,8Z,11Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/20:0/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/20:0/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/20:0/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/20:0/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/20:0/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/20:0/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/20:0/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/20:0/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/20:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/20:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/20:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/20:0/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/20:0/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/20:1(11Z)/20:1(11Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/20:1(11Z)/20:2(11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/20:1(11Z)/20:3(5Z,8Z,11Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/20:1(11Z)/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/20:1(11Z)/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/20:1(11Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/20:1(11Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/20:1(11Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/20:1(11Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/20:1(11Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/20:1(11Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/20:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/20:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/20:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/20:1(11Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/20:1(11Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/20:2(11Z,14Z)/20:2(11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/20:2(11Z,14Z)/20:3(5Z,8Z,11Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/20:2(11Z,14Z)/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/20:2(11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/20:2(11Z,14Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/20:2(11Z,14Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/20:2(11Z,14Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/20:2(11Z,14Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/20:2(11Z,14Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/20:2(11Z,14Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/20:2(11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/20:2(11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/20:2(11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/20:2(11Z,14Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/20:2(11Z,14Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/20:3(5Z,8Z,11Z)/20:3(5Z,8Z,11Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/20:3(5Z,8Z,11Z)/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/20:3(5Z,8Z,11Z)/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/20:3(5Z,8Z,11Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/20:3(5Z,8Z,11Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/20:3(5Z,8Z,11Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/20:3(5Z,8Z,11Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/20:3(5Z,8Z,11Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/20:3(5Z,8Z,11Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/20:3(5Z,8Z,11Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/20:3(5Z,8Z,11Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/20:3(5Z,8Z,11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/20:3(5Z,8Z,11Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/20:3(5Z,8Z,11Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/20:3(8Z,11Z,14Z)/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/20:3(8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/20:3(8Z,11Z,14Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/20:3(8Z,11Z,14Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/20:3(8Z,11Z,14Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/20:3(8Z,11Z,14Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/20:3(8Z,11Z,14Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/20:3(8Z,11Z,14Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/20:3(8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/20:3(8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/20:3(8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/20:3(8Z,11Z,14Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/20:3(8Z,11Z,14Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/20:4(5Z,8Z,11Z,14Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/20:4(5Z,8Z,11Z,14Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/20:4(5Z,8Z,11Z,14Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/20:4(5Z,8Z,11Z,14Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/20:4(5Z,8Z,11Z,14Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/20:4(5Z,8Z,11Z,14Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/20:4(5Z,8Z,11Z,14Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/20:4(5Z,8Z,11Z,14Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/20:4(8Z,11Z,14Z,17Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/20:4(8Z,11Z,14Z,17Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/20:4(8Z,11Z,14Z,17Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/20:4(8Z,11Z,14Z,17Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/20:4(8Z,11Z,14Z,17Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/20:4(8Z,11Z,14Z,17Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/20:4(8Z,11Z,14Z,17Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/20:4(8Z,11Z,14Z,17Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/20:4(8Z,11Z,14Z,17Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/20:4(8Z,11Z,14Z,17Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/20:4(8Z,11Z,14Z,17Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/20:5(5Z,8Z,11Z,14Z,17Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/20:5(5Z,8Z,11Z,14Z,17Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/20:5(5Z,8Z,11Z,14Z,17Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/20:5(5Z,8Z,11Z,14Z,17Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/20:5(5Z,8Z,11Z,14Z,17Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/20:5(5Z,8Z,11Z,14Z,17Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/20:5(5Z,8Z,11Z,14Z,17Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/20:5(5Z,8Z,11Z,14Z,17Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/20:5(5Z,8Z,11Z,14Z,17Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/20:5(5Z,8Z,11Z,14Z,17Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/22:0/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/22:0/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/22:0/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/22:0/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/22:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/22:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/22:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/22:0/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/22:0/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/22:1(13Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/22:1(13Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/22:1(13Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/22:1(13Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/22:1(13Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/22:1(13Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/22:1(13Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/22:1(13Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/22:2(13Z,16Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/22:2(13Z,16Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/22:2(13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/22:2(13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/22:2(13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/22:2(13Z,16Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/22:2(13Z,16Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/22:4(7Z,10Z,13Z,16Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/22:4(7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/22:4(7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/22:4(7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/22:4(7Z,10Z,13Z,16Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/22:4(7Z,10Z,13Z,16Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/24:0/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/24:0/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(14:1(9Z)/24:1(15Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/15:0/15:0)
  • De Novo Triacylglycerol Biosynthesis TG(15:0/15:0/16:0)
  • De Novo Triacylglycerol Biosynthesis TG(15:0/15:0/16:1(9Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/15:0/18:0)
  • De Novo Triacylglycerol Biosynthesis TG(15:0/15:0/18:1(11Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/15:0/18:1(9Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/15:0/18:2(9Z,12Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/15:0/18:3(6Z,9Z,12Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/15:0/18:3(9Z,12Z,15Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/15:0/18:4(6Z,9Z,12Z,15Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/15:0/20:0)
  • De Novo Triacylglycerol Biosynthesis TG(15:0/15:0/20:1(11Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/15:0/20:2(11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/15:0/20:3(5Z,8Z,11Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/15:0/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/15:0/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/15:0/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/15:0/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/15:0/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(15:0/15:0/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/15:0/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/15:0/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/15:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/15:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/15:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/15:0/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(15:0/15:0/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/16:0/16:0)
  • De Novo Triacylglycerol Biosynthesis TG(15:0/16:0/16:1(9Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/16:0/18:0)
  • De Novo Triacylglycerol Biosynthesis TG(15:0/16:0/18:1(11Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/16:0/18:1(9Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/16:0/18:2(9Z,12Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/16:0/18:3(6Z,9Z,12Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/16:0/18:3(9Z,12Z,15Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/16:0/18:4(6Z,9Z,12Z,15Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/16:0/20:0)
  • De Novo Triacylglycerol Biosynthesis TG(15:0/16:0/20:1(11Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/16:0/20:2(11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/16:0/20:3(5Z,8Z,11Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/16:0/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/16:0/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/16:0/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/16:0/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/16:0/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(15:0/16:0/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/16:0/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/16:0/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/16:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/16:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/16:0/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(15:0/16:0/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/16:1(9Z)/16:1(9Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/16:1(9Z)/18:0)
  • De Novo Triacylglycerol Biosynthesis TG(15:0/16:1(9Z)/18:1(11Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/16:1(9Z)/18:1(9Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/16:1(9Z)/18:2(9Z,12Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/16:1(9Z)/18:3(6Z,9Z,12Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/16:1(9Z)/18:3(9Z,12Z,15Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/16:1(9Z)/18:4(6Z,9Z,12Z,15Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/16:1(9Z)/20:0)
  • De Novo Triacylglycerol Biosynthesis TG(15:0/16:1(9Z)/20:1(11Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/16:1(9Z)/20:2(11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/16:1(9Z)/20:3(5Z,8Z,11Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/16:1(9Z)/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/16:1(9Z)/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/16:1(9Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/16:1(9Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/16:1(9Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(15:0/16:1(9Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/16:1(9Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/16:1(9Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/16:1(9Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(15:0/16:1(9Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/18:0/18:0)
  • De Novo Triacylglycerol Biosynthesis TG(15:0/18:0/18:1(11Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/18:0/18:1(9Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/18:0/18:2(9Z,12Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/18:0/18:3(6Z,9Z,12Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/18:0/18:3(9Z,12Z,15Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/18:0/18:4(6Z,9Z,12Z,15Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/18:0/20:0)
  • De Novo Triacylglycerol Biosynthesis TG(15:0/18:0/20:1(11Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/18:0/20:2(11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/18:0/20:3(5Z,8Z,11Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/18:0/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/18:0/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/18:0/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/18:0/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/18:0/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(15:0/18:0/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/18:0/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/18:0/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/18:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/18:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/18:0/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(15:0/18:0/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/18:1(11Z)/18:1(11Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/18:1(11Z)/18:1(9Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/18:1(11Z)/18:2(9Z,12Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/18:1(11Z)/18:3(6Z,9Z,12Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/18:1(11Z)/18:3(9Z,12Z,15Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/18:1(11Z)/18:4(6Z,9Z,12Z,15Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/18:1(11Z)/20:0)
  • De Novo Triacylglycerol Biosynthesis TG(15:0/18:1(11Z)/20:1(11Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/18:1(11Z)/20:2(11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/18:1(11Z)/20:3(5Z,8Z,11Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/18:1(11Z)/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/18:1(11Z)/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/18:1(11Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/18:1(11Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/18:1(11Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(15:0/18:1(11Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/18:1(11Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/18:1(11Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/18:1(11Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(15:0/18:1(11Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/18:1(9Z)/18:1(9Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/18:1(9Z)/18:2(9Z,12Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/18:1(9Z)/18:3(6Z,9Z,12Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/18:1(9Z)/18:3(9Z,12Z,15Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/18:1(9Z)/18:4(6Z,9Z,12Z,15Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/18:1(9Z)/20:0)
  • De Novo Triacylglycerol Biosynthesis TG(15:0/18:1(9Z)/20:1(11Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/18:1(9Z)/20:2(11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/18:1(9Z)/20:3(5Z,8Z,11Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/18:1(9Z)/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/18:1(9Z)/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/18:1(9Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/18:1(9Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/18:1(9Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(15:0/18:1(9Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/18:1(9Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/18:1(9Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/18:1(9Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(15:0/18:1(9Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/18:2(9Z,12Z)/18:2(9Z,12Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/18:2(9Z,12Z)/18:3(6Z,9Z,12Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/18:2(9Z,12Z)/18:3(9Z,12Z,15Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/18:2(9Z,12Z)/18:4(6Z,9Z,12Z,15Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/18:2(9Z,12Z)/20:0)
  • De Novo Triacylglycerol Biosynthesis TG(15:0/18:2(9Z,12Z)/20:1(11Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/18:2(9Z,12Z)/20:2(11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/18:2(9Z,12Z)/20:3(5Z,8Z,11Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/18:2(9Z,12Z)/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/18:2(9Z,12Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/18:2(9Z,12Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/18:2(9Z,12Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(15:0/18:2(9Z,12Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/18:2(9Z,12Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/18:2(9Z,12Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/18:2(9Z,12Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(15:0/18:2(9Z,12Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/18:3(6Z,9Z,12Z)/18:3(6Z,9Z,12Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/18:3(6Z,9Z,12Z)/18:3(9Z,12Z,15Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/18:3(6Z,9Z,12Z)/18:4(6Z,9Z,12Z,15Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/18:3(6Z,9Z,12Z)/20:0)
  • De Novo Triacylglycerol Biosynthesis TG(15:0/18:3(6Z,9Z,12Z)/20:1(11Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/18:3(6Z,9Z,12Z)/20:2(11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/18:3(6Z,9Z,12Z)/20:3(5Z,8Z,11Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/18:3(6Z,9Z,12Z)/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/18:3(6Z,9Z,12Z)/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/18:3(6Z,9Z,12Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/18:3(6Z,9Z,12Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/18:3(6Z,9Z,12Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(15:0/18:3(6Z,9Z,12Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/18:3(6Z,9Z,12Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/18:3(6Z,9Z,12Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/18:3(6Z,9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/18:3(6Z,9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/18:3(6Z,9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/18:3(6Z,9Z,12Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(15:0/18:3(6Z,9Z,12Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/18:3(9Z,12Z,15Z)/18:3(9Z,12Z,15Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/18:3(9Z,12Z,15Z)/18:4(6Z,9Z,12Z,15Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/18:3(9Z,12Z,15Z)/20:0)
  • De Novo Triacylglycerol Biosynthesis TG(15:0/18:3(9Z,12Z,15Z)/20:1(11Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/18:3(9Z,12Z,15Z)/20:2(11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/18:3(9Z,12Z,15Z)/20:3(5Z,8Z,11Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/18:3(9Z,12Z,15Z)/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/18:3(9Z,12Z,15Z)/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/18:3(9Z,12Z,15Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/18:3(9Z,12Z,15Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/18:3(9Z,12Z,15Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(15:0/18:3(9Z,12Z,15Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/18:3(9Z,12Z,15Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/18:3(9Z,12Z,15Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/18:3(9Z,12Z,15Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/18:3(9Z,12Z,15Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/18:3(9Z,12Z,15Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/18:3(9Z,12Z,15Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(15:0/18:3(9Z,12Z,15Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/18:4(6Z,9Z,12Z,15Z)/18:4(6Z,9Z,12Z,15Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/18:4(6Z,9Z,12Z,15Z)/20:0)
  • De Novo Triacylglycerol Biosynthesis TG(15:0/18:4(6Z,9Z,12Z,15Z)/20:1(11Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/18:4(6Z,9Z,12Z,15Z)/20:2(11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/18:4(6Z,9Z,12Z,15Z)/20:3(5Z,8Z,11Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/18:4(6Z,9Z,12Z,15Z)/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/18:4(6Z,9Z,12Z,15Z)/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/18:4(6Z,9Z,12Z,15Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/18:4(6Z,9Z,12Z,15Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/18:4(6Z,9Z,12Z,15Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(15:0/18:4(6Z,9Z,12Z,15Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/18:4(6Z,9Z,12Z,15Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/18:4(6Z,9Z,12Z,15Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/18:4(6Z,9Z,12Z,15Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/18:4(6Z,9Z,12Z,15Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/18:4(6Z,9Z,12Z,15Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/18:4(6Z,9Z,12Z,15Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(15:0/18:4(6Z,9Z,12Z,15Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/20:0/20:0)
  • De Novo Triacylglycerol Biosynthesis TG(15:0/20:0/20:1(11Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/20:0/20:2(11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/20:0/20:3(5Z,8Z,11Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/20:0/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/20:0/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/20:0/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/20:0/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/20:0/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(15:0/20:0/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/20:0/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/20:0/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/20:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/20:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/20:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/20:0/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(15:0/20:0/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/20:1(11Z)/20:1(11Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/20:1(11Z)/20:2(11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/20:1(11Z)/20:3(5Z,8Z,11Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/20:1(11Z)/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/20:1(11Z)/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/20:1(11Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/20:1(11Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/20:1(11Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(15:0/20:1(11Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/20:1(11Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/20:1(11Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/20:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/20:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/20:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/20:1(11Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(15:0/20:1(11Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/20:2(11Z,14Z)/20:2(11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/20:2(11Z,14Z)/20:3(5Z,8Z,11Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/20:2(11Z,14Z)/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/20:2(11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/20:2(11Z,14Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/20:2(11Z,14Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/20:2(11Z,14Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(15:0/20:2(11Z,14Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/20:2(11Z,14Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/20:2(11Z,14Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/20:2(11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/20:2(11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/20:2(11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/20:2(11Z,14Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(15:0/20:2(11Z,14Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/20:3(5Z,8Z,11Z)/20:3(5Z,8Z,11Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/20:3(5Z,8Z,11Z)/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/20:3(5Z,8Z,11Z)/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/20:3(5Z,8Z,11Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/20:3(5Z,8Z,11Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/20:3(5Z,8Z,11Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(15:0/20:3(5Z,8Z,11Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/20:3(5Z,8Z,11Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/20:3(5Z,8Z,11Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/20:3(5Z,8Z,11Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/20:3(5Z,8Z,11Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/20:3(5Z,8Z,11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/20:3(5Z,8Z,11Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(15:0/20:3(5Z,8Z,11Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/20:3(8Z,11Z,14Z)/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/20:3(8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/20:3(8Z,11Z,14Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/20:3(8Z,11Z,14Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/20:3(8Z,11Z,14Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(15:0/20:3(8Z,11Z,14Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/20:3(8Z,11Z,14Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/20:3(8Z,11Z,14Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/20:3(8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/20:3(8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/20:3(8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/20:3(8Z,11Z,14Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(15:0/20:3(8Z,11Z,14Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/20:4(5Z,8Z,11Z,14Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/20:4(5Z,8Z,11Z,14Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/20:4(5Z,8Z,11Z,14Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(15:0/20:4(5Z,8Z,11Z,14Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/20:4(5Z,8Z,11Z,14Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/20:4(5Z,8Z,11Z,14Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/20:4(5Z,8Z,11Z,14Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(15:0/20:4(5Z,8Z,11Z,14Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/20:4(8Z,11Z,14Z,17Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/20:4(8Z,11Z,14Z,17Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/20:4(8Z,11Z,14Z,17Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(15:0/20:4(8Z,11Z,14Z,17Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/20:4(8Z,11Z,14Z,17Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/20:4(8Z,11Z,14Z,17Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/20:4(8Z,11Z,14Z,17Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/20:4(8Z,11Z,14Z,17Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/20:4(8Z,11Z,14Z,17Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/20:4(8Z,11Z,14Z,17Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(15:0/20:4(8Z,11Z,14Z,17Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/20:5(5Z,8Z,11Z,14Z,17Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/20:5(5Z,8Z,11Z,14Z,17Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(15:0/20:5(5Z,8Z,11Z,14Z,17Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/20:5(5Z,8Z,11Z,14Z,17Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/20:5(5Z,8Z,11Z,14Z,17Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/20:5(5Z,8Z,11Z,14Z,17Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/20:5(5Z,8Z,11Z,14Z,17Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/20:5(5Z,8Z,11Z,14Z,17Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/20:5(5Z,8Z,11Z,14Z,17Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(15:0/20:5(5Z,8Z,11Z,14Z,17Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/22:0/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(15:0/22:0/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/22:0/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/22:0/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/22:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/22:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/22:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/22:0/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(15:0/22:0/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/22:1(13Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/22:1(13Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/22:1(13Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/22:1(13Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/22:1(13Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/22:1(13Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/22:1(13Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(15:0/22:1(13Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/22:2(13Z,16Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/22:2(13Z,16Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/22:2(13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/22:2(13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/22:2(13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/22:2(13Z,16Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(15:0/22:2(13Z,16Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/22:4(7Z,10Z,13Z,16Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/22:4(7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/22:4(7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/22:4(7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/22:4(7Z,10Z,13Z,16Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(15:0/22:4(7Z,10Z,13Z,16Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/22:5(4Z,7Z,10Z,13Z,16Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(15:0/22:5(4Z,7Z,10Z,13Z,16Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/22:5(7Z,10Z,13Z,16Z,19Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(15:0/22:5(7Z,10Z,13Z,16Z,19Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(15:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/24:0/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(15:0/24:0/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(15:0/24:1(15Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/16:0/16:0)
  • De Novo Triacylglycerol Biosynthesis TG(16:0/16:0/16:1(9Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/16:0/18:0)
  • De Novo Triacylglycerol Biosynthesis TG(16:0/16:0/18:1(11Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/16:0/18:1(9Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/16:0/18:2(9Z,12Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/16:0/18:3(6Z,9Z,12Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/16:0/18:3(9Z,12Z,15Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/16:0/18:4(6Z,9Z,12Z,15Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/16:0/20:0)
  • De Novo Triacylglycerol Biosynthesis TG(16:0/16:0/20:1(11Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/16:0/20:2(11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/16:0/20:3(5Z,8Z,11Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/16:0/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/16:0/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/16:0/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/16:0/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/16:0/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(16:0/16:0/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/16:0/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/16:0/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/16:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/16:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/16:0/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(16:0/16:0/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/16:1(9Z)/16:1(9Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/16:1(9Z)/18:0)
  • De Novo Triacylglycerol Biosynthesis TG(16:0/16:1(9Z)/18:1(11Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/16:1(9Z)/18:1(9Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/16:1(9Z)/18:2(9Z,12Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/16:1(9Z)/18:3(6Z,9Z,12Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/16:1(9Z)/18:3(9Z,12Z,15Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/16:1(9Z)/18:4(6Z,9Z,12Z,15Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/16:1(9Z)/20:0)
  • De Novo Triacylglycerol Biosynthesis TG(16:0/16:1(9Z)/20:1(11Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/16:1(9Z)/20:2(11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/16:1(9Z)/20:3(5Z,8Z,11Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/16:1(9Z)/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/16:1(9Z)/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/16:1(9Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/16:1(9Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/16:1(9Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(16:0/16:1(9Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/16:1(9Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/16:1(9Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/16:1(9Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(16:0/16:1(9Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/18:0/18:0)
  • De Novo Triacylglycerol Biosynthesis TG(16:0/18:0/18:1(11Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/18:0/18:1(9Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/18:0/18:2(9Z,12Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/18:0/18:3(6Z,9Z,12Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/18:0/18:3(9Z,12Z,15Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/18:0/18:4(6Z,9Z,12Z,15Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/18:0/20:0)
  • De Novo Triacylglycerol Biosynthesis TG(16:0/18:0/20:1(11Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/18:0/20:2(11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/18:0/20:3(5Z,8Z,11Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/18:0/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/18:0/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/18:0/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/18:0/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/18:0/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(16:0/18:0/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/18:0/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/18:0/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/18:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/18:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/18:0/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(16:0/18:0/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/18:1(11Z)/18:1(11Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/18:1(11Z)/18:1(9Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/18:1(11Z)/18:2(9Z,12Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/18:1(11Z)/18:3(6Z,9Z,12Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/18:1(11Z)/18:3(9Z,12Z,15Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/18:1(11Z)/18:4(6Z,9Z,12Z,15Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/18:1(11Z)/20:0)
  • De Novo Triacylglycerol Biosynthesis TG(16:0/18:1(11Z)/20:1(11Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/18:1(11Z)/20:2(11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/18:1(11Z)/20:3(5Z,8Z,11Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/18:1(11Z)/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/18:1(11Z)/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/18:1(11Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/18:1(11Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/18:1(11Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(16:0/18:1(11Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/18:1(11Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/18:1(11Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/18:1(11Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(16:0/18:1(11Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/18:1(9Z)/18:1(9Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/18:1(9Z)/18:2(9Z,12Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/18:1(9Z)/18:3(6Z,9Z,12Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/18:1(9Z)/18:3(9Z,12Z,15Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/18:1(9Z)/18:4(6Z,9Z,12Z,15Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/18:1(9Z)/20:0)
  • De Novo Triacylglycerol Biosynthesis TG(16:0/18:1(9Z)/20:1(11Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/18:1(9Z)/20:2(11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/18:1(9Z)/20:3(5Z,8Z,11Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/18:1(9Z)/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/18:1(9Z)/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/18:1(9Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/18:1(9Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/18:1(9Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(16:0/18:1(9Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/18:1(9Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/18:1(9Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/18:1(9Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(16:0/18:1(9Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/18:2(9Z,12Z)/18:2(9Z,12Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/18:2(9Z,12Z)/18:3(6Z,9Z,12Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/18:2(9Z,12Z)/18:3(9Z,12Z,15Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/18:2(9Z,12Z)/18:4(6Z,9Z,12Z,15Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/18:2(9Z,12Z)/20:0)
  • De Novo Triacylglycerol Biosynthesis TG(16:0/18:2(9Z,12Z)/20:1(11Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/18:2(9Z,12Z)/20:2(11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/18:2(9Z,12Z)/20:3(5Z,8Z,11Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/18:2(9Z,12Z)/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/18:2(9Z,12Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/18:2(9Z,12Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/18:2(9Z,12Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(16:0/18:2(9Z,12Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/18:2(9Z,12Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/18:2(9Z,12Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/18:2(9Z,12Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(16:0/18:2(9Z,12Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/18:3(6Z,9Z,12Z)/18:3(6Z,9Z,12Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/18:3(6Z,9Z,12Z)/18:3(9Z,12Z,15Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/18:3(6Z,9Z,12Z)/18:4(6Z,9Z,12Z,15Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/18:3(6Z,9Z,12Z)/20:0)
  • De Novo Triacylglycerol Biosynthesis TG(16:0/18:3(6Z,9Z,12Z)/20:1(11Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/18:3(6Z,9Z,12Z)/20:2(11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/18:3(6Z,9Z,12Z)/20:3(5Z,8Z,11Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/18:3(6Z,9Z,12Z)/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/18:3(6Z,9Z,12Z)/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/18:3(6Z,9Z,12Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/18:3(6Z,9Z,12Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/18:3(6Z,9Z,12Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(16:0/18:3(6Z,9Z,12Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/18:3(6Z,9Z,12Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/18:3(6Z,9Z,12Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/18:3(6Z,9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/18:3(6Z,9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/18:3(6Z,9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/18:3(6Z,9Z,12Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(16:0/18:3(6Z,9Z,12Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/18:3(9Z,12Z,15Z)/18:3(9Z,12Z,15Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/18:3(9Z,12Z,15Z)/18:4(6Z,9Z,12Z,15Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/18:3(9Z,12Z,15Z)/20:0)
  • De Novo Triacylglycerol Biosynthesis TG(16:0/18:3(9Z,12Z,15Z)/20:1(11Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/18:3(9Z,12Z,15Z)/20:2(11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/18:3(9Z,12Z,15Z)/20:3(5Z,8Z,11Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/18:3(9Z,12Z,15Z)/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/18:3(9Z,12Z,15Z)/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/18:3(9Z,12Z,15Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/18:3(9Z,12Z,15Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/18:3(9Z,12Z,15Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(16:0/18:3(9Z,12Z,15Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/18:3(9Z,12Z,15Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/18:3(9Z,12Z,15Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/18:3(9Z,12Z,15Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/18:3(9Z,12Z,15Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/18:3(9Z,12Z,15Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/18:3(9Z,12Z,15Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(16:0/18:3(9Z,12Z,15Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/18:4(6Z,9Z,12Z,15Z)/18:4(6Z,9Z,12Z,15Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/18:4(6Z,9Z,12Z,15Z)/20:0)
  • De Novo Triacylglycerol Biosynthesis TG(16:0/18:4(6Z,9Z,12Z,15Z)/20:1(11Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/18:4(6Z,9Z,12Z,15Z)/20:2(11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/18:4(6Z,9Z,12Z,15Z)/20:3(5Z,8Z,11Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/18:4(6Z,9Z,12Z,15Z)/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/18:4(6Z,9Z,12Z,15Z)/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/18:4(6Z,9Z,12Z,15Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/18:4(6Z,9Z,12Z,15Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/18:4(6Z,9Z,12Z,15Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(16:0/18:4(6Z,9Z,12Z,15Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/18:4(6Z,9Z,12Z,15Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/18:4(6Z,9Z,12Z,15Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/18:4(6Z,9Z,12Z,15Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/18:4(6Z,9Z,12Z,15Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/18:4(6Z,9Z,12Z,15Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/18:4(6Z,9Z,12Z,15Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(16:0/18:4(6Z,9Z,12Z,15Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/20:0/20:0)
  • De Novo Triacylglycerol Biosynthesis TG(16:0/20:0/20:1(11Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/20:0/20:2(11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/20:0/20:3(5Z,8Z,11Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/20:0/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/20:0/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/20:0/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/20:0/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/20:0/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(16:0/20:0/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/20:0/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/20:0/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/20:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/20:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/20:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/20:0/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(16:0/20:0/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/20:1(11Z)/20:1(11Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/20:1(11Z)/20:2(11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/20:1(11Z)/20:3(5Z,8Z,11Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/20:1(11Z)/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/20:1(11Z)/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/20:1(11Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/20:1(11Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/20:1(11Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(16:0/20:1(11Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/20:1(11Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/20:1(11Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/20:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/20:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/20:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/20:1(11Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(16:0/20:1(11Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/20:2(11Z,14Z)/20:2(11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/20:2(11Z,14Z)/20:3(5Z,8Z,11Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/20:2(11Z,14Z)/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/20:2(11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/20:2(11Z,14Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/20:2(11Z,14Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/20:2(11Z,14Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(16:0/20:2(11Z,14Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/20:2(11Z,14Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/20:2(11Z,14Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/20:2(11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/20:2(11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/20:2(11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/20:2(11Z,14Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(16:0/20:2(11Z,14Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/20:3(5Z,8Z,11Z)/20:3(5Z,8Z,11Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/20:3(5Z,8Z,11Z)/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/20:3(5Z,8Z,11Z)/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/20:3(5Z,8Z,11Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/20:3(5Z,8Z,11Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/20:3(5Z,8Z,11Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(16:0/20:3(5Z,8Z,11Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/20:3(5Z,8Z,11Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/20:3(5Z,8Z,11Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/20:3(5Z,8Z,11Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/20:3(5Z,8Z,11Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/20:3(5Z,8Z,11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/20:3(5Z,8Z,11Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(16:0/20:3(5Z,8Z,11Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/20:3(8Z,11Z,14Z)/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/20:3(8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/20:3(8Z,11Z,14Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/20:3(8Z,11Z,14Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/20:3(8Z,11Z,14Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(16:0/20:3(8Z,11Z,14Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/20:3(8Z,11Z,14Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/20:3(8Z,11Z,14Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/20:3(8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/20:3(8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/20:3(8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/20:3(8Z,11Z,14Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(16:0/20:3(8Z,11Z,14Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/20:4(5Z,8Z,11Z,14Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/20:4(5Z,8Z,11Z,14Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/20:4(5Z,8Z,11Z,14Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(16:0/20:4(5Z,8Z,11Z,14Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/20:4(5Z,8Z,11Z,14Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/20:4(5Z,8Z,11Z,14Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/20:4(5Z,8Z,11Z,14Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(16:0/20:4(5Z,8Z,11Z,14Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/20:4(8Z,11Z,14Z,17Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/20:4(8Z,11Z,14Z,17Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/20:4(8Z,11Z,14Z,17Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(16:0/20:4(8Z,11Z,14Z,17Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/20:4(8Z,11Z,14Z,17Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/20:4(8Z,11Z,14Z,17Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/20:4(8Z,11Z,14Z,17Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/20:4(8Z,11Z,14Z,17Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/20:4(8Z,11Z,14Z,17Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/20:4(8Z,11Z,14Z,17Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(16:0/20:4(8Z,11Z,14Z,17Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/20:5(5Z,8Z,11Z,14Z,17Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/20:5(5Z,8Z,11Z,14Z,17Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(16:0/20:5(5Z,8Z,11Z,14Z,17Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/20:5(5Z,8Z,11Z,14Z,17Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/20:5(5Z,8Z,11Z,14Z,17Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/20:5(5Z,8Z,11Z,14Z,17Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/20:5(5Z,8Z,11Z,14Z,17Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/20:5(5Z,8Z,11Z,14Z,17Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/20:5(5Z,8Z,11Z,14Z,17Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(16:0/20:5(5Z,8Z,11Z,14Z,17Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/22:0/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(16:0/22:0/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/22:0/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/22:0/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/22:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/22:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/22:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/22:0/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(16:0/22:0/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/22:1(13Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/22:1(13Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/22:1(13Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/22:1(13Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/22:1(13Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/22:1(13Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/22:1(13Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(16:0/22:1(13Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/22:2(13Z,16Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/22:2(13Z,16Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/22:2(13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/22:2(13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/22:2(13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/22:2(13Z,16Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(16:0/22:2(13Z,16Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/22:4(7Z,10Z,13Z,16Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/22:4(7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/22:4(7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/22:4(7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/22:4(7Z,10Z,13Z,16Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(16:0/22:4(7Z,10Z,13Z,16Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/22:5(4Z,7Z,10Z,13Z,16Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(16:0/22:5(4Z,7Z,10Z,13Z,16Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/22:5(7Z,10Z,13Z,16Z,19Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(16:0/22:5(7Z,10Z,13Z,16Z,19Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/24:0/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(16:0/24:0/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:0/24:1(15Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/16:1(9Z)/16:1(9Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/16:1(9Z)/18:0)
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/16:1(9Z)/18:1(11Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/16:1(9Z)/18:1(9Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/16:1(9Z)/18:2(9Z,12Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/16:1(9Z)/18:3(6Z,9Z,12Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/16:1(9Z)/18:3(9Z,12Z,15Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/16:1(9Z)/18:4(6Z,9Z,12Z,15Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/16:1(9Z)/20:0)
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/16:1(9Z)/20:1(11Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/16:1(9Z)/20:2(11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/16:1(9Z)/20:3(5Z,8Z,11Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/16:1(9Z)/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/16:1(9Z)/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/16:1(9Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/16:1(9Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/16:1(9Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/16:1(9Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/16:1(9Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/16:1(9Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/16:1(9Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/16:1(9Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/18:0/18:0)
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/18:0/18:1(11Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/18:0/18:1(9Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/18:0/18:2(9Z,12Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/18:0/18:3(6Z,9Z,12Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/18:0/18:3(9Z,12Z,15Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/18:0/18:4(6Z,9Z,12Z,15Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/18:0/20:0)
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/18:0/20:1(11Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/18:0/20:2(11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/18:0/20:3(5Z,8Z,11Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/18:0/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/18:0/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/18:0/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/18:0/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/18:0/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/18:0/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/18:0/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/18:0/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/18:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/18:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/18:0/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/18:0/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/18:1(11Z)/18:1(11Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/18:1(11Z)/18:1(9Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/18:1(11Z)/18:2(9Z,12Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/18:1(11Z)/18:3(6Z,9Z,12Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/18:1(11Z)/18:3(9Z,12Z,15Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/18:1(11Z)/18:4(6Z,9Z,12Z,15Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/18:1(11Z)/20:0)
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/18:1(11Z)/20:1(11Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/18:1(11Z)/20:2(11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/18:1(11Z)/20:3(5Z,8Z,11Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/18:1(11Z)/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/18:1(11Z)/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/18:1(11Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/18:1(11Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/18:1(11Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/18:1(11Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/18:1(11Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/18:1(11Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/18:1(11Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/18:1(11Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/18:1(9Z)/18:1(9Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/18:1(9Z)/18:2(9Z,12Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/18:1(9Z)/18:3(6Z,9Z,12Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/18:1(9Z)/18:3(9Z,12Z,15Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/18:1(9Z)/18:4(6Z,9Z,12Z,15Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/18:1(9Z)/20:0)
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/18:1(9Z)/20:1(11Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/18:1(9Z)/20:2(11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/18:1(9Z)/20:3(5Z,8Z,11Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/18:1(9Z)/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/18:1(9Z)/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/18:1(9Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/18:1(9Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/18:1(9Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/18:1(9Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/18:1(9Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/18:1(9Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/18:1(9Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/18:1(9Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/18:2(9Z,12Z)/18:2(9Z,12Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/18:2(9Z,12Z)/18:3(6Z,9Z,12Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/18:2(9Z,12Z)/18:3(9Z,12Z,15Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/18:2(9Z,12Z)/18:4(6Z,9Z,12Z,15Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/18:2(9Z,12Z)/20:0)
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/18:2(9Z,12Z)/20:1(11Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/18:2(9Z,12Z)/20:2(11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/18:2(9Z,12Z)/20:3(5Z,8Z,11Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/18:2(9Z,12Z)/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/18:2(9Z,12Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/18:2(9Z,12Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/18:2(9Z,12Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/18:2(9Z,12Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/18:2(9Z,12Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/18:2(9Z,12Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/18:2(9Z,12Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/18:2(9Z,12Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/18:3(6Z,9Z,12Z)/18:3(6Z,9Z,12Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/18:3(6Z,9Z,12Z)/18:3(9Z,12Z,15Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/18:3(6Z,9Z,12Z)/18:4(6Z,9Z,12Z,15Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/18:3(6Z,9Z,12Z)/20:0)
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/18:3(6Z,9Z,12Z)/20:1(11Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/18:3(6Z,9Z,12Z)/20:2(11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/18:3(6Z,9Z,12Z)/20:3(5Z,8Z,11Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/18:3(6Z,9Z,12Z)/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/18:3(6Z,9Z,12Z)/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/18:3(6Z,9Z,12Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/18:3(6Z,9Z,12Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/18:3(6Z,9Z,12Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/18:3(6Z,9Z,12Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/18:3(6Z,9Z,12Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/18:3(6Z,9Z,12Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/18:3(6Z,9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/18:3(6Z,9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/18:3(6Z,9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/18:3(6Z,9Z,12Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/18:3(6Z,9Z,12Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/18:3(9Z,12Z,15Z)/18:3(9Z,12Z,15Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/18:3(9Z,12Z,15Z)/18:4(6Z,9Z,12Z,15Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/18:3(9Z,12Z,15Z)/20:0)
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/18:3(9Z,12Z,15Z)/20:1(11Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/18:3(9Z,12Z,15Z)/20:2(11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/18:3(9Z,12Z,15Z)/20:3(5Z,8Z,11Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/18:3(9Z,12Z,15Z)/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/18:3(9Z,12Z,15Z)/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/18:3(9Z,12Z,15Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/18:3(9Z,12Z,15Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/18:3(9Z,12Z,15Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/18:3(9Z,12Z,15Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/18:3(9Z,12Z,15Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/18:3(9Z,12Z,15Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/18:3(9Z,12Z,15Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/18:3(9Z,12Z,15Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/18:3(9Z,12Z,15Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/18:3(9Z,12Z,15Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/18:3(9Z,12Z,15Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/18:4(6Z,9Z,12Z,15Z)/18:4(6Z,9Z,12Z,15Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/18:4(6Z,9Z,12Z,15Z)/20:0)
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/18:4(6Z,9Z,12Z,15Z)/20:1(11Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/18:4(6Z,9Z,12Z,15Z)/20:2(11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/18:4(6Z,9Z,12Z,15Z)/20:3(5Z,8Z,11Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/18:4(6Z,9Z,12Z,15Z)/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/18:4(6Z,9Z,12Z,15Z)/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/18:4(6Z,9Z,12Z,15Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/18:4(6Z,9Z,12Z,15Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/18:4(6Z,9Z,12Z,15Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/18:4(6Z,9Z,12Z,15Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/18:4(6Z,9Z,12Z,15Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/18:4(6Z,9Z,12Z,15Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/18:4(6Z,9Z,12Z,15Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/18:4(6Z,9Z,12Z,15Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/18:4(6Z,9Z,12Z,15Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/18:4(6Z,9Z,12Z,15Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/18:4(6Z,9Z,12Z,15Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/20:0/20:0)
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/20:0/20:1(11Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/20:0/20:2(11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/20:0/20:3(5Z,8Z,11Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/20:0/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/20:0/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/20:0/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/20:0/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/20:0/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/20:0/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/20:0/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/20:0/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/20:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/20:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/20:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/20:0/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/20:0/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/20:1(11Z)/20:1(11Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/20:1(11Z)/20:2(11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/20:1(11Z)/20:3(5Z,8Z,11Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/20:1(11Z)/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/20:1(11Z)/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/20:1(11Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/20:1(11Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/20:1(11Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/20:1(11Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/20:1(11Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/20:1(11Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/20:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/20:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/20:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/20:1(11Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/20:1(11Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/20:2(11Z,14Z)/20:2(11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/20:2(11Z,14Z)/20:3(5Z,8Z,11Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/20:2(11Z,14Z)/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/20:2(11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/20:2(11Z,14Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/20:2(11Z,14Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/20:2(11Z,14Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/20:2(11Z,14Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/20:2(11Z,14Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/20:2(11Z,14Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/20:2(11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/20:2(11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/20:2(11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/20:2(11Z,14Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/20:2(11Z,14Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/20:3(5Z,8Z,11Z)/20:3(5Z,8Z,11Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/20:3(5Z,8Z,11Z)/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/20:3(5Z,8Z,11Z)/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/20:3(5Z,8Z,11Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/20:3(5Z,8Z,11Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/20:3(5Z,8Z,11Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/20:3(5Z,8Z,11Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/20:3(5Z,8Z,11Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/20:3(5Z,8Z,11Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/20:3(5Z,8Z,11Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/20:3(5Z,8Z,11Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/20:3(5Z,8Z,11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/20:3(5Z,8Z,11Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/20:3(5Z,8Z,11Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/20:3(8Z,11Z,14Z)/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/20:3(8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/20:3(8Z,11Z,14Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/20:3(8Z,11Z,14Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/20:3(8Z,11Z,14Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/20:3(8Z,11Z,14Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/20:3(8Z,11Z,14Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/20:3(8Z,11Z,14Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/20:3(8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/20:3(8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/20:3(8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/20:3(8Z,11Z,14Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/20:3(8Z,11Z,14Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/20:4(8Z,11Z,14Z,17Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/20:4(8Z,11Z,14Z,17Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/20:4(8Z,11Z,14Z,17Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/20:4(8Z,11Z,14Z,17Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/20:4(8Z,11Z,14Z,17Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/20:4(8Z,11Z,14Z,17Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/20:4(8Z,11Z,14Z,17Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/20:4(8Z,11Z,14Z,17Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/20:4(8Z,11Z,14Z,17Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/20:4(8Z,11Z,14Z,17Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/20:4(8Z,11Z,14Z,17Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/20:5(5Z,8Z,11Z,14Z,17Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/20:5(5Z,8Z,11Z,14Z,17Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/20:5(5Z,8Z,11Z,14Z,17Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/20:5(5Z,8Z,11Z,14Z,17Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/20:5(5Z,8Z,11Z,14Z,17Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/20:5(5Z,8Z,11Z,14Z,17Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/20:5(5Z,8Z,11Z,14Z,17Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/20:5(5Z,8Z,11Z,14Z,17Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/20:5(5Z,8Z,11Z,14Z,17Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/20:5(5Z,8Z,11Z,14Z,17Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/22:0/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/22:0/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/22:0/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/22:0/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/22:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/22:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/22:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/22:0/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/22:0/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/22:1(13Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/22:1(13Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/22:1(13Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/22:1(13Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/22:1(13Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/22:1(13Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/22:1(13Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/22:1(13Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/22:2(13Z,16Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/22:2(13Z,16Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/22:2(13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/22:2(13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/22:2(13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/22:2(13Z,16Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/22:2(13Z,16Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/22:4(7Z,10Z,13Z,16Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/22:4(7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/22:4(7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/22:4(7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/22:4(7Z,10Z,13Z,16Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/22:4(7Z,10Z,13Z,16Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/24:0/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/24:0/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(16:1(9Z)/24:1(15Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/18:0/18:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:0/18:0/18:1(11Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/18:0/18:1(9Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/18:0/18:2(9Z,12Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/18:0/18:3(6Z,9Z,12Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/18:0/18:3(9Z,12Z,15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/18:0/18:4(6Z,9Z,12Z,15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/18:0/20:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:0/18:0/20:1(11Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/18:0/20:2(11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/18:0/20:3(5Z,8Z,11Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/18:0/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/18:0/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/18:0/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/18:0/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/18:0/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:0/18:0/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/18:0/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/18:0/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/18:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/18:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/18:0/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:0/18:0/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/18:1(11Z)/18:1(11Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/18:1(11Z)/18:1(9Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/18:1(11Z)/18:2(9Z,12Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/18:1(11Z)/18:3(6Z,9Z,12Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/18:1(11Z)/18:3(9Z,12Z,15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/18:1(11Z)/18:4(6Z,9Z,12Z,15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/18:1(11Z)/20:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:0/18:1(11Z)/20:1(11Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/18:1(11Z)/20:2(11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/18:1(11Z)/20:3(5Z,8Z,11Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/18:1(11Z)/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/18:1(11Z)/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/18:1(11Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/18:1(11Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/18:1(11Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:0/18:1(11Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/18:1(11Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/18:1(11Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/18:1(11Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:0/18:1(11Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/18:1(9Z)/18:1(9Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/18:1(9Z)/18:2(9Z,12Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/18:1(9Z)/18:3(6Z,9Z,12Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/18:1(9Z)/18:3(9Z,12Z,15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/18:1(9Z)/18:4(6Z,9Z,12Z,15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/18:1(9Z)/20:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:0/18:1(9Z)/20:1(11Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/18:1(9Z)/20:2(11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/18:1(9Z)/20:3(5Z,8Z,11Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/18:1(9Z)/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/18:1(9Z)/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/18:1(9Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/18:1(9Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/18:1(9Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:0/18:1(9Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/18:1(9Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/18:1(9Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/18:1(9Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:0/18:1(9Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/18:2(9Z,12Z)/18:2(9Z,12Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/18:2(9Z,12Z)/18:3(6Z,9Z,12Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/18:2(9Z,12Z)/18:3(9Z,12Z,15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/18:2(9Z,12Z)/18:4(6Z,9Z,12Z,15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/18:2(9Z,12Z)/20:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:0/18:2(9Z,12Z)/20:1(11Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/18:2(9Z,12Z)/20:2(11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/18:2(9Z,12Z)/20:3(5Z,8Z,11Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/18:2(9Z,12Z)/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/18:2(9Z,12Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/18:2(9Z,12Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/18:2(9Z,12Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:0/18:2(9Z,12Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/18:2(9Z,12Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/18:2(9Z,12Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/18:2(9Z,12Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:0/18:2(9Z,12Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/18:3(6Z,9Z,12Z)/18:3(6Z,9Z,12Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/18:3(6Z,9Z,12Z)/18:3(9Z,12Z,15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/18:3(6Z,9Z,12Z)/18:4(6Z,9Z,12Z,15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/18:3(6Z,9Z,12Z)/20:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:0/18:3(6Z,9Z,12Z)/20:1(11Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/18:3(6Z,9Z,12Z)/20:2(11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/18:3(6Z,9Z,12Z)/20:3(5Z,8Z,11Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/18:3(6Z,9Z,12Z)/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/18:3(6Z,9Z,12Z)/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/18:3(6Z,9Z,12Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/18:3(6Z,9Z,12Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/18:3(6Z,9Z,12Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:0/18:3(6Z,9Z,12Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/18:3(6Z,9Z,12Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/18:3(6Z,9Z,12Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/18:3(6Z,9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/18:3(6Z,9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/18:3(6Z,9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/18:3(6Z,9Z,12Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:0/18:3(6Z,9Z,12Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/18:3(9Z,12Z,15Z)/18:3(9Z,12Z,15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/18:3(9Z,12Z,15Z)/18:4(6Z,9Z,12Z,15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/18:3(9Z,12Z,15Z)/20:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:0/18:3(9Z,12Z,15Z)/20:1(11Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/18:3(9Z,12Z,15Z)/20:2(11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/18:3(9Z,12Z,15Z)/20:3(5Z,8Z,11Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/18:3(9Z,12Z,15Z)/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/18:3(9Z,12Z,15Z)/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/18:3(9Z,12Z,15Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/18:3(9Z,12Z,15Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/18:3(9Z,12Z,15Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:0/18:3(9Z,12Z,15Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/18:3(9Z,12Z,15Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/18:3(9Z,12Z,15Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/18:3(9Z,12Z,15Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/18:3(9Z,12Z,15Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/18:3(9Z,12Z,15Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/18:3(9Z,12Z,15Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:0/18:3(9Z,12Z,15Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/18:4(6Z,9Z,12Z,15Z)/18:4(6Z,9Z,12Z,15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/18:4(6Z,9Z,12Z,15Z)/20:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:0/18:4(6Z,9Z,12Z,15Z)/20:1(11Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/18:4(6Z,9Z,12Z,15Z)/20:2(11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/18:4(6Z,9Z,12Z,15Z)/20:3(5Z,8Z,11Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/18:4(6Z,9Z,12Z,15Z)/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/18:4(6Z,9Z,12Z,15Z)/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/18:4(6Z,9Z,12Z,15Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/18:4(6Z,9Z,12Z,15Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/18:4(6Z,9Z,12Z,15Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:0/18:4(6Z,9Z,12Z,15Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/18:4(6Z,9Z,12Z,15Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/18:4(6Z,9Z,12Z,15Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/18:4(6Z,9Z,12Z,15Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/18:4(6Z,9Z,12Z,15Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/18:4(6Z,9Z,12Z,15Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/18:4(6Z,9Z,12Z,15Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:0/18:4(6Z,9Z,12Z,15Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/20:0/20:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:0/20:0/20:1(11Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/20:0/20:2(11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/20:0/20:3(5Z,8Z,11Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/20:0/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/20:0/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/20:0/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/20:0/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/20:0/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:0/20:0/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/20:0/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/20:0/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/20:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/20:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/20:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/20:0/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:0/20:0/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/20:1(11Z)/20:1(11Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/20:1(11Z)/20:2(11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/20:1(11Z)/20:3(5Z,8Z,11Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/20:1(11Z)/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/20:1(11Z)/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/20:1(11Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/20:1(11Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/20:1(11Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:0/20:1(11Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/20:1(11Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/20:1(11Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/20:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/20:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/20:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/20:1(11Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:0/20:1(11Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/20:2(11Z,14Z)/20:2(11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/20:2(11Z,14Z)/20:3(5Z,8Z,11Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/20:2(11Z,14Z)/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/20:2(11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/20:2(11Z,14Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/20:2(11Z,14Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/20:2(11Z,14Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:0/20:2(11Z,14Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/20:2(11Z,14Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/20:2(11Z,14Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/20:2(11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/20:2(11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/20:2(11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/20:2(11Z,14Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:0/20:2(11Z,14Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/20:3(5Z,8Z,11Z)/20:3(5Z,8Z,11Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/20:3(5Z,8Z,11Z)/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/20:3(5Z,8Z,11Z)/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/20:3(5Z,8Z,11Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/20:3(5Z,8Z,11Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/20:3(5Z,8Z,11Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:0/20:3(5Z,8Z,11Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/20:3(5Z,8Z,11Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/20:3(5Z,8Z,11Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/20:3(5Z,8Z,11Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/20:3(5Z,8Z,11Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/20:3(5Z,8Z,11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/20:3(5Z,8Z,11Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:0/20:3(5Z,8Z,11Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/20:3(8Z,11Z,14Z)/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/20:3(8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/20:3(8Z,11Z,14Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/20:3(8Z,11Z,14Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/20:3(8Z,11Z,14Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:0/20:3(8Z,11Z,14Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/20:3(8Z,11Z,14Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/20:3(8Z,11Z,14Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/20:3(8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/20:3(8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/20:3(8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/20:3(8Z,11Z,14Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:0/20:3(8Z,11Z,14Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/20:4(5Z,8Z,11Z,14Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/20:4(5Z,8Z,11Z,14Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/20:4(5Z,8Z,11Z,14Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:0/20:4(5Z,8Z,11Z,14Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/20:4(5Z,8Z,11Z,14Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/20:4(5Z,8Z,11Z,14Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/20:4(5Z,8Z,11Z,14Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:0/20:4(5Z,8Z,11Z,14Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/20:4(8Z,11Z,14Z,17Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/20:4(8Z,11Z,14Z,17Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/20:4(8Z,11Z,14Z,17Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:0/20:4(8Z,11Z,14Z,17Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/20:4(8Z,11Z,14Z,17Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/20:4(8Z,11Z,14Z,17Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/20:4(8Z,11Z,14Z,17Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/20:4(8Z,11Z,14Z,17Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/20:4(8Z,11Z,14Z,17Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/20:4(8Z,11Z,14Z,17Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:0/20:4(8Z,11Z,14Z,17Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/20:5(5Z,8Z,11Z,14Z,17Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/20:5(5Z,8Z,11Z,14Z,17Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:0/20:5(5Z,8Z,11Z,14Z,17Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/20:5(5Z,8Z,11Z,14Z,17Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/20:5(5Z,8Z,11Z,14Z,17Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/20:5(5Z,8Z,11Z,14Z,17Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/20:5(5Z,8Z,11Z,14Z,17Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/20:5(5Z,8Z,11Z,14Z,17Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/20:5(5Z,8Z,11Z,14Z,17Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:0/20:5(5Z,8Z,11Z,14Z,17Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/22:0/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:0/22:0/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/22:0/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/22:0/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/22:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/22:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/22:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/22:0/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:0/22:0/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/22:1(13Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/22:1(13Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/22:1(13Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/22:1(13Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/22:1(13Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/22:1(13Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/22:1(13Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:0/22:1(13Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/22:2(13Z,16Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/22:2(13Z,16Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/22:2(13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/22:2(13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/22:2(13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/22:2(13Z,16Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:0/22:2(13Z,16Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/22:4(7Z,10Z,13Z,16Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/22:4(7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/22:4(7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/22:4(7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/22:4(7Z,10Z,13Z,16Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:0/22:4(7Z,10Z,13Z,16Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/22:5(4Z,7Z,10Z,13Z,16Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:0/22:5(4Z,7Z,10Z,13Z,16Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/22:5(7Z,10Z,13Z,16Z,19Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:0/22:5(7Z,10Z,13Z,16Z,19Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/24:0/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:0/24:0/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:0/24:1(15Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/18:1(11Z)/18:1(11Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/18:1(11Z)/18:1(9Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/18:1(11Z)/18:2(9Z,12Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/18:1(11Z)/18:3(6Z,9Z,12Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/18:1(11Z)/18:3(9Z,12Z,15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/18:1(11Z)/18:4(6Z,9Z,12Z,15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/18:1(11Z)/20:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/18:1(11Z)/20:1(11Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/18:1(11Z)/20:2(11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/18:1(11Z)/20:3(5Z,8Z,11Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/18:1(11Z)/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/18:1(11Z)/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/18:1(11Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/18:1(11Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/18:1(11Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/18:1(11Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/18:1(11Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/18:1(11Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/18:1(11Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/18:1(11Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/18:1(9Z)/18:1(9Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/18:1(9Z)/18:2(9Z,12Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/18:1(9Z)/18:3(6Z,9Z,12Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/18:1(9Z)/18:3(9Z,12Z,15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/18:1(9Z)/18:4(6Z,9Z,12Z,15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/18:1(9Z)/20:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/18:1(9Z)/20:1(11Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/18:1(9Z)/20:2(11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/18:1(9Z)/20:3(5Z,8Z,11Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/18:1(9Z)/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/18:1(9Z)/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/18:1(9Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/18:1(9Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/18:1(9Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/18:1(9Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/18:1(9Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/18:1(9Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/18:1(9Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/18:1(9Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/18:2(9Z,12Z)/18:2(9Z,12Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/18:2(9Z,12Z)/18:3(6Z,9Z,12Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/18:2(9Z,12Z)/18:3(9Z,12Z,15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/18:2(9Z,12Z)/18:4(6Z,9Z,12Z,15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/18:2(9Z,12Z)/20:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/18:2(9Z,12Z)/20:1(11Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/18:2(9Z,12Z)/20:2(11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/18:2(9Z,12Z)/20:3(5Z,8Z,11Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/18:2(9Z,12Z)/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/18:2(9Z,12Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/18:2(9Z,12Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/18:2(9Z,12Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/18:2(9Z,12Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/18:2(9Z,12Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/18:2(9Z,12Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/18:2(9Z,12Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/18:2(9Z,12Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/18:3(6Z,9Z,12Z)/18:3(6Z,9Z,12Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/18:3(6Z,9Z,12Z)/18:3(9Z,12Z,15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/18:3(6Z,9Z,12Z)/18:4(6Z,9Z,12Z,15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/18:3(6Z,9Z,12Z)/20:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/18:3(6Z,9Z,12Z)/20:1(11Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/18:3(6Z,9Z,12Z)/20:2(11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/18:3(6Z,9Z,12Z)/20:3(5Z,8Z,11Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/18:3(6Z,9Z,12Z)/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/18:3(6Z,9Z,12Z)/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/18:3(6Z,9Z,12Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/18:3(6Z,9Z,12Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/18:3(6Z,9Z,12Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/18:3(6Z,9Z,12Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/18:3(6Z,9Z,12Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/18:3(6Z,9Z,12Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/18:3(6Z,9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/18:3(6Z,9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/18:3(6Z,9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/18:3(6Z,9Z,12Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/18:3(6Z,9Z,12Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/18:3(9Z,12Z,15Z)/18:3(9Z,12Z,15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/18:3(9Z,12Z,15Z)/18:4(6Z,9Z,12Z,15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/18:3(9Z,12Z,15Z)/20:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/18:3(9Z,12Z,15Z)/20:1(11Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/18:3(9Z,12Z,15Z)/20:2(11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/18:3(9Z,12Z,15Z)/20:3(5Z,8Z,11Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/18:3(9Z,12Z,15Z)/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/18:3(9Z,12Z,15Z)/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/18:3(9Z,12Z,15Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/18:3(9Z,12Z,15Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/18:3(9Z,12Z,15Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/18:3(9Z,12Z,15Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/18:3(9Z,12Z,15Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/18:3(9Z,12Z,15Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/18:3(9Z,12Z,15Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/18:3(9Z,12Z,15Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/18:3(9Z,12Z,15Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/18:3(9Z,12Z,15Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/18:3(9Z,12Z,15Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/18:4(6Z,9Z,12Z,15Z)/18:4(6Z,9Z,12Z,15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/18:4(6Z,9Z,12Z,15Z)/20:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/18:4(6Z,9Z,12Z,15Z)/20:1(11Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/18:4(6Z,9Z,12Z,15Z)/20:2(11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/18:4(6Z,9Z,12Z,15Z)/20:3(5Z,8Z,11Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/18:4(6Z,9Z,12Z,15Z)/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/18:4(6Z,9Z,12Z,15Z)/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/18:4(6Z,9Z,12Z,15Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/18:4(6Z,9Z,12Z,15Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/18:4(6Z,9Z,12Z,15Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/18:4(6Z,9Z,12Z,15Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/18:4(6Z,9Z,12Z,15Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/18:4(6Z,9Z,12Z,15Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/18:4(6Z,9Z,12Z,15Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/18:4(6Z,9Z,12Z,15Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/18:4(6Z,9Z,12Z,15Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/18:4(6Z,9Z,12Z,15Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/18:4(6Z,9Z,12Z,15Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/20:0/20:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/20:0/20:1(11Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/20:0/20:2(11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/20:0/20:3(5Z,8Z,11Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/20:0/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/20:0/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/20:0/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/20:0/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/20:0/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/20:0/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/20:0/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/20:0/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/20:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/20:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/20:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/20:0/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/20:0/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/20:1(11Z)/20:1(11Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/20:1(11Z)/20:2(11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/20:1(11Z)/20:3(5Z,8Z,11Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/20:1(11Z)/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/20:1(11Z)/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/20:1(11Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/20:1(11Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/20:1(11Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/20:1(11Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/20:1(11Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/20:1(11Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/20:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/20:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/20:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/20:1(11Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/20:1(11Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/20:2(11Z,14Z)/20:2(11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/20:2(11Z,14Z)/20:3(5Z,8Z,11Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/20:2(11Z,14Z)/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/20:2(11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/20:2(11Z,14Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/20:2(11Z,14Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/20:2(11Z,14Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/20:2(11Z,14Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/20:2(11Z,14Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/20:2(11Z,14Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/20:2(11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/20:2(11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/20:2(11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/20:2(11Z,14Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/20:2(11Z,14Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/20:3(5Z,8Z,11Z)/20:3(5Z,8Z,11Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/20:3(5Z,8Z,11Z)/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/20:3(5Z,8Z,11Z)/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/20:3(5Z,8Z,11Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/20:3(5Z,8Z,11Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/20:3(5Z,8Z,11Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/20:3(5Z,8Z,11Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/20:3(5Z,8Z,11Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/20:3(5Z,8Z,11Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/20:3(5Z,8Z,11Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/20:3(5Z,8Z,11Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/20:3(5Z,8Z,11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/20:3(5Z,8Z,11Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/20:3(5Z,8Z,11Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/20:3(8Z,11Z,14Z)/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/20:3(8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/20:3(8Z,11Z,14Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/20:3(8Z,11Z,14Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/20:3(8Z,11Z,14Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/20:3(8Z,11Z,14Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/20:3(8Z,11Z,14Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/20:3(8Z,11Z,14Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/20:3(8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/20:3(8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/20:3(8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/20:3(8Z,11Z,14Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/20:3(8Z,11Z,14Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/20:4(8Z,11Z,14Z,17Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/20:4(8Z,11Z,14Z,17Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/20:4(8Z,11Z,14Z,17Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/20:4(8Z,11Z,14Z,17Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/20:4(8Z,11Z,14Z,17Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/20:4(8Z,11Z,14Z,17Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/20:4(8Z,11Z,14Z,17Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/20:4(8Z,11Z,14Z,17Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/20:4(8Z,11Z,14Z,17Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/20:4(8Z,11Z,14Z,17Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/20:4(8Z,11Z,14Z,17Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/20:5(5Z,8Z,11Z,14Z,17Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/20:5(5Z,8Z,11Z,14Z,17Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/20:5(5Z,8Z,11Z,14Z,17Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/20:5(5Z,8Z,11Z,14Z,17Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/20:5(5Z,8Z,11Z,14Z,17Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/20:5(5Z,8Z,11Z,14Z,17Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/20:5(5Z,8Z,11Z,14Z,17Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/20:5(5Z,8Z,11Z,14Z,17Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/20:5(5Z,8Z,11Z,14Z,17Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/20:5(5Z,8Z,11Z,14Z,17Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/22:0/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/22:0/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/22:0/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/22:0/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/22:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/22:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/22:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/22:0/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/22:0/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/22:1(13Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/22:1(13Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/22:1(13Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/22:1(13Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/22:1(13Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/22:1(13Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/22:1(13Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/22:1(13Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/22:2(13Z,16Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/22:2(13Z,16Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/22:2(13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/22:2(13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/22:2(13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/22:2(13Z,16Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/22:2(13Z,16Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/22:4(7Z,10Z,13Z,16Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/22:4(7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/22:4(7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/22:4(7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/22:4(7Z,10Z,13Z,16Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/22:4(7Z,10Z,13Z,16Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/24:0/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/24:0/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(11Z)/24:1(15Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/18:1(9Z)/18:1(9Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/18:1(9Z)/18:2(9Z,12Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/18:1(9Z)/18:3(6Z,9Z,12Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/18:1(9Z)/18:3(9Z,12Z,15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/18:1(9Z)/18:4(6Z,9Z,12Z,15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/18:1(9Z)/20:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/18:1(9Z)/20:1(11Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/18:1(9Z)/20:2(11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/18:1(9Z)/20:3(5Z,8Z,11Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/18:1(9Z)/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/18:1(9Z)/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/18:1(9Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/18:1(9Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/18:1(9Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/18:1(9Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/18:1(9Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/18:1(9Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/18:1(9Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/18:1(9Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/18:2(9Z,12Z)/18:2(9Z,12Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/18:2(9Z,12Z)/18:3(6Z,9Z,12Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/18:2(9Z,12Z)/18:3(9Z,12Z,15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/18:2(9Z,12Z)/18:4(6Z,9Z,12Z,15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/18:2(9Z,12Z)/20:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/18:2(9Z,12Z)/20:1(11Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/18:2(9Z,12Z)/20:2(11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/18:2(9Z,12Z)/20:3(5Z,8Z,11Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/18:2(9Z,12Z)/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/18:2(9Z,12Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/18:2(9Z,12Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/18:2(9Z,12Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/18:2(9Z,12Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/18:2(9Z,12Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/18:2(9Z,12Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/18:2(9Z,12Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/18:2(9Z,12Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/18:3(6Z,9Z,12Z)/18:3(6Z,9Z,12Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/18:3(6Z,9Z,12Z)/18:3(9Z,12Z,15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/18:3(6Z,9Z,12Z)/18:4(6Z,9Z,12Z,15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/18:3(6Z,9Z,12Z)/20:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/18:3(6Z,9Z,12Z)/20:1(11Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/18:3(6Z,9Z,12Z)/20:2(11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/18:3(6Z,9Z,12Z)/20:3(5Z,8Z,11Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/18:3(6Z,9Z,12Z)/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/18:3(6Z,9Z,12Z)/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/18:3(6Z,9Z,12Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/18:3(6Z,9Z,12Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/18:3(6Z,9Z,12Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/18:3(6Z,9Z,12Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/18:3(6Z,9Z,12Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/18:3(6Z,9Z,12Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/18:3(6Z,9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/18:3(6Z,9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/18:3(6Z,9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/18:3(6Z,9Z,12Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/18:3(6Z,9Z,12Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/18:3(9Z,12Z,15Z)/18:3(9Z,12Z,15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/18:3(9Z,12Z,15Z)/18:4(6Z,9Z,12Z,15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/18:3(9Z,12Z,15Z)/20:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/18:3(9Z,12Z,15Z)/20:1(11Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/18:3(9Z,12Z,15Z)/20:2(11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/18:3(9Z,12Z,15Z)/20:3(5Z,8Z,11Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/18:3(9Z,12Z,15Z)/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/18:3(9Z,12Z,15Z)/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/18:3(9Z,12Z,15Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/18:3(9Z,12Z,15Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/18:3(9Z,12Z,15Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/18:3(9Z,12Z,15Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/18:3(9Z,12Z,15Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/18:3(9Z,12Z,15Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/18:3(9Z,12Z,15Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/18:3(9Z,12Z,15Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/18:3(9Z,12Z,15Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/18:3(9Z,12Z,15Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/18:3(9Z,12Z,15Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/18:4(6Z,9Z,12Z,15Z)/18:4(6Z,9Z,12Z,15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/18:4(6Z,9Z,12Z,15Z)/20:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/18:4(6Z,9Z,12Z,15Z)/20:1(11Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/18:4(6Z,9Z,12Z,15Z)/20:2(11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/18:4(6Z,9Z,12Z,15Z)/20:3(5Z,8Z,11Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/18:4(6Z,9Z,12Z,15Z)/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/18:4(6Z,9Z,12Z,15Z)/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/18:4(6Z,9Z,12Z,15Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/18:4(6Z,9Z,12Z,15Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/18:4(6Z,9Z,12Z,15Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/18:4(6Z,9Z,12Z,15Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/18:4(6Z,9Z,12Z,15Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/18:4(6Z,9Z,12Z,15Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/18:4(6Z,9Z,12Z,15Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/18:4(6Z,9Z,12Z,15Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/18:4(6Z,9Z,12Z,15Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/18:4(6Z,9Z,12Z,15Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/18:4(6Z,9Z,12Z,15Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/20:0/20:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/20:0/20:1(11Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/20:0/20:2(11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/20:0/20:3(5Z,8Z,11Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/20:0/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/20:0/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/20:0/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/20:0/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/20:0/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/20:0/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/20:0/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/20:0/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/20:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/20:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/20:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/20:0/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/20:0/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/20:1(11Z)/20:1(11Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/20:1(11Z)/20:2(11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/20:1(11Z)/20:3(5Z,8Z,11Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/20:1(11Z)/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/20:1(11Z)/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/20:1(11Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/20:1(11Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/20:1(11Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/20:1(11Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/20:1(11Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/20:1(11Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/20:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/20:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/20:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/20:1(11Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/20:1(11Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/20:2(11Z,14Z)/20:2(11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/20:2(11Z,14Z)/20:3(5Z,8Z,11Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/20:2(11Z,14Z)/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/20:2(11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/20:2(11Z,14Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/20:2(11Z,14Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/20:2(11Z,14Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/20:2(11Z,14Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/20:2(11Z,14Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/20:2(11Z,14Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/20:2(11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/20:2(11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/20:2(11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/20:2(11Z,14Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/20:2(11Z,14Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/20:3(5Z,8Z,11Z)/20:3(5Z,8Z,11Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/20:3(5Z,8Z,11Z)/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/20:3(5Z,8Z,11Z)/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/20:3(5Z,8Z,11Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/20:3(5Z,8Z,11Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/20:3(5Z,8Z,11Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/20:3(5Z,8Z,11Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/20:3(5Z,8Z,11Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/20:3(5Z,8Z,11Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/20:3(5Z,8Z,11Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/20:3(5Z,8Z,11Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/20:3(5Z,8Z,11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/20:3(5Z,8Z,11Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/20:3(5Z,8Z,11Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/20:3(8Z,11Z,14Z)/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/20:3(8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/20:3(8Z,11Z,14Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/20:3(8Z,11Z,14Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/20:3(8Z,11Z,14Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/20:3(8Z,11Z,14Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/20:3(8Z,11Z,14Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/20:3(8Z,11Z,14Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/20:3(8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/20:3(8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/20:3(8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/20:3(8Z,11Z,14Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/20:3(8Z,11Z,14Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/20:4(8Z,11Z,14Z,17Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/20:4(8Z,11Z,14Z,17Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/20:4(8Z,11Z,14Z,17Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/20:4(8Z,11Z,14Z,17Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/20:4(8Z,11Z,14Z,17Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/20:4(8Z,11Z,14Z,17Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/20:4(8Z,11Z,14Z,17Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/20:4(8Z,11Z,14Z,17Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/20:4(8Z,11Z,14Z,17Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/20:4(8Z,11Z,14Z,17Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/20:4(8Z,11Z,14Z,17Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/20:5(5Z,8Z,11Z,14Z,17Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/20:5(5Z,8Z,11Z,14Z,17Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/20:5(5Z,8Z,11Z,14Z,17Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/20:5(5Z,8Z,11Z,14Z,17Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/20:5(5Z,8Z,11Z,14Z,17Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/20:5(5Z,8Z,11Z,14Z,17Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/20:5(5Z,8Z,11Z,14Z,17Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/20:5(5Z,8Z,11Z,14Z,17Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/20:5(5Z,8Z,11Z,14Z,17Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/20:5(5Z,8Z,11Z,14Z,17Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/22:0/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/22:0/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/22:0/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/22:0/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/22:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/22:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/22:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/22:0/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/22:0/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/22:1(13Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/22:1(13Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/22:1(13Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/22:1(13Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/22:1(13Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/22:1(13Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/22:1(13Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/22:1(13Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/22:2(13Z,16Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/22:2(13Z,16Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/22:2(13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/22:2(13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/22:2(13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/22:2(13Z,16Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/22:2(13Z,16Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/22:4(7Z,10Z,13Z,16Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/22:4(7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/22:4(7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/22:4(7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/22:4(7Z,10Z,13Z,16Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/22:4(7Z,10Z,13Z,16Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/24:0/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/24:0/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:1(9Z)/24:1(15Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/18:2(9Z,12Z)/18:2(9Z,12Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/18:2(9Z,12Z)/18:3(6Z,9Z,12Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/18:2(9Z,12Z)/18:3(9Z,12Z,15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/18:2(9Z,12Z)/18:4(6Z,9Z,12Z,15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/18:2(9Z,12Z)/20:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/18:2(9Z,12Z)/20:1(11Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/18:2(9Z,12Z)/20:2(11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/18:2(9Z,12Z)/20:3(5Z,8Z,11Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/18:2(9Z,12Z)/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/18:2(9Z,12Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/18:2(9Z,12Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/18:2(9Z,12Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/18:2(9Z,12Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/18:2(9Z,12Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/18:2(9Z,12Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/18:2(9Z,12Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/18:2(9Z,12Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/18:3(6Z,9Z,12Z)/18:3(6Z,9Z,12Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/18:3(6Z,9Z,12Z)/18:3(9Z,12Z,15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/18:3(6Z,9Z,12Z)/18:4(6Z,9Z,12Z,15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/18:3(6Z,9Z,12Z)/20:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/18:3(6Z,9Z,12Z)/20:1(11Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/18:3(6Z,9Z,12Z)/20:2(11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/18:3(6Z,9Z,12Z)/20:3(5Z,8Z,11Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/18:3(6Z,9Z,12Z)/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/18:3(6Z,9Z,12Z)/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/18:3(6Z,9Z,12Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/18:3(6Z,9Z,12Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/18:3(6Z,9Z,12Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/18:3(6Z,9Z,12Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/18:3(6Z,9Z,12Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/18:3(6Z,9Z,12Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/18:3(6Z,9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/18:3(6Z,9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/18:3(6Z,9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/18:3(6Z,9Z,12Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/18:3(6Z,9Z,12Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/18:3(9Z,12Z,15Z)/18:3(9Z,12Z,15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/18:3(9Z,12Z,15Z)/18:4(6Z,9Z,12Z,15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/18:3(9Z,12Z,15Z)/20:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/18:3(9Z,12Z,15Z)/20:1(11Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/18:3(9Z,12Z,15Z)/20:2(11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/18:3(9Z,12Z,15Z)/20:3(5Z,8Z,11Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/18:3(9Z,12Z,15Z)/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/18:3(9Z,12Z,15Z)/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/18:3(9Z,12Z,15Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/18:3(9Z,12Z,15Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/18:3(9Z,12Z,15Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/18:3(9Z,12Z,15Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/18:3(9Z,12Z,15Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/18:3(9Z,12Z,15Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/18:3(9Z,12Z,15Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/18:3(9Z,12Z,15Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/18:3(9Z,12Z,15Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/18:3(9Z,12Z,15Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/18:3(9Z,12Z,15Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/18:4(6Z,9Z,12Z,15Z)/18:4(6Z,9Z,12Z,15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/18:4(6Z,9Z,12Z,15Z)/20:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/18:4(6Z,9Z,12Z,15Z)/20:1(11Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/18:4(6Z,9Z,12Z,15Z)/20:2(11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/18:4(6Z,9Z,12Z,15Z)/20:3(5Z,8Z,11Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/18:4(6Z,9Z,12Z,15Z)/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/18:4(6Z,9Z,12Z,15Z)/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/18:4(6Z,9Z,12Z,15Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/18:4(6Z,9Z,12Z,15Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/18:4(6Z,9Z,12Z,15Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/18:4(6Z,9Z,12Z,15Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/18:4(6Z,9Z,12Z,15Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/18:4(6Z,9Z,12Z,15Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/18:4(6Z,9Z,12Z,15Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/18:4(6Z,9Z,12Z,15Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/18:4(6Z,9Z,12Z,15Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/18:4(6Z,9Z,12Z,15Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/18:4(6Z,9Z,12Z,15Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/20:0/20:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/20:0/20:1(11Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/20:0/20:2(11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/20:0/20:3(5Z,8Z,11Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/20:0/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/20:0/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/20:0/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/20:0/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/20:0/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/20:0/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/20:0/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/20:0/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/20:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/20:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/20:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/20:0/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/20:0/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/20:1(11Z)/20:1(11Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/20:1(11Z)/20:2(11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/20:1(11Z)/20:3(5Z,8Z,11Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/20:1(11Z)/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/20:1(11Z)/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/20:1(11Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/20:1(11Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/20:1(11Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/20:1(11Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/20:1(11Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/20:1(11Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/20:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/20:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/20:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/20:1(11Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/20:1(11Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/20:2(11Z,14Z)/20:2(11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/20:2(11Z,14Z)/20:3(5Z,8Z,11Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/20:2(11Z,14Z)/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/20:2(11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/20:2(11Z,14Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/20:2(11Z,14Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/20:2(11Z,14Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/20:2(11Z,14Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/20:2(11Z,14Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/20:2(11Z,14Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/20:2(11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/20:2(11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/20:2(11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/20:2(11Z,14Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/20:2(11Z,14Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/20:3(5Z,8Z,11Z)/20:3(5Z,8Z,11Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/20:3(5Z,8Z,11Z)/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/20:3(5Z,8Z,11Z)/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/20:3(5Z,8Z,11Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/20:3(5Z,8Z,11Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/20:3(5Z,8Z,11Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/20:3(5Z,8Z,11Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/20:3(5Z,8Z,11Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/20:3(5Z,8Z,11Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/20:3(5Z,8Z,11Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/20:3(5Z,8Z,11Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/20:3(5Z,8Z,11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/20:3(5Z,8Z,11Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/20:3(5Z,8Z,11Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/20:3(8Z,11Z,14Z)/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/20:3(8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/20:3(8Z,11Z,14Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/20:3(8Z,11Z,14Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/20:3(8Z,11Z,14Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/20:3(8Z,11Z,14Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/20:3(8Z,11Z,14Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/20:3(8Z,11Z,14Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/20:3(8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/20:3(8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/20:3(8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/20:3(8Z,11Z,14Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/20:3(8Z,11Z,14Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/20:4(8Z,11Z,14Z,17Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/20:4(8Z,11Z,14Z,17Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/20:4(8Z,11Z,14Z,17Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/20:4(8Z,11Z,14Z,17Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/20:4(8Z,11Z,14Z,17Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/20:4(8Z,11Z,14Z,17Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/20:4(8Z,11Z,14Z,17Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/20:4(8Z,11Z,14Z,17Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/20:4(8Z,11Z,14Z,17Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/20:4(8Z,11Z,14Z,17Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/20:4(8Z,11Z,14Z,17Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/20:5(5Z,8Z,11Z,14Z,17Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/20:5(5Z,8Z,11Z,14Z,17Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/20:5(5Z,8Z,11Z,14Z,17Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/20:5(5Z,8Z,11Z,14Z,17Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/20:5(5Z,8Z,11Z,14Z,17Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/20:5(5Z,8Z,11Z,14Z,17Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/20:5(5Z,8Z,11Z,14Z,17Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/20:5(5Z,8Z,11Z,14Z,17Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/20:5(5Z,8Z,11Z,14Z,17Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/20:5(5Z,8Z,11Z,14Z,17Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/22:0/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/22:0/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/22:0/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/22:0/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/22:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/22:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/22:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/22:0/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/22:0/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/22:1(13Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/22:1(13Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/22:1(13Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/22:1(13Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/22:1(13Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/22:1(13Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/22:1(13Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/22:1(13Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/22:2(13Z,16Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/22:2(13Z,16Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/22:2(13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/22:2(13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/22:2(13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/22:2(13Z,16Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/22:2(13Z,16Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/22:4(7Z,10Z,13Z,16Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/22:4(7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/22:4(7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/22:4(7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/22:4(7Z,10Z,13Z,16Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/22:4(7Z,10Z,13Z,16Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/24:0/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/24:0/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:2(9Z,12Z)/24:1(15Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/18:3(6Z,9Z,12Z)/18:3(6Z,9Z,12Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/18:3(6Z,9Z,12Z)/18:3(9Z,12Z,15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/18:3(6Z,9Z,12Z)/18:4(6Z,9Z,12Z,15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/18:3(6Z,9Z,12Z)/20:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/18:3(6Z,9Z,12Z)/20:1(11Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/18:3(6Z,9Z,12Z)/20:2(11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/18:3(6Z,9Z,12Z)/20:3(5Z,8Z,11Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/18:3(6Z,9Z,12Z)/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/18:3(6Z,9Z,12Z)/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/18:3(6Z,9Z,12Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/18:3(6Z,9Z,12Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/18:3(6Z,9Z,12Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/18:3(6Z,9Z,12Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/18:3(6Z,9Z,12Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/18:3(6Z,9Z,12Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/18:3(6Z,9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/18:3(6Z,9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/18:3(6Z,9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/18:3(6Z,9Z,12Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/18:3(6Z,9Z,12Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/18:3(9Z,12Z,15Z)/18:3(9Z,12Z,15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/18:3(9Z,12Z,15Z)/18:4(6Z,9Z,12Z,15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/18:3(9Z,12Z,15Z)/20:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/18:3(9Z,12Z,15Z)/20:1(11Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/18:3(9Z,12Z,15Z)/20:2(11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/18:3(9Z,12Z,15Z)/20:3(5Z,8Z,11Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/18:3(9Z,12Z,15Z)/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/18:3(9Z,12Z,15Z)/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/18:3(9Z,12Z,15Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/18:3(9Z,12Z,15Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/18:3(9Z,12Z,15Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/18:3(9Z,12Z,15Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/18:3(9Z,12Z,15Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/18:3(9Z,12Z,15Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/18:3(9Z,12Z,15Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/18:3(9Z,12Z,15Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/18:3(9Z,12Z,15Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/18:3(9Z,12Z,15Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/18:3(9Z,12Z,15Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/18:4(6Z,9Z,12Z,15Z)/18:4(6Z,9Z,12Z,15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/18:4(6Z,9Z,12Z,15Z)/20:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/18:4(6Z,9Z,12Z,15Z)/20:1(11Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/18:4(6Z,9Z,12Z,15Z)/20:2(11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/18:4(6Z,9Z,12Z,15Z)/20:3(5Z,8Z,11Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/18:4(6Z,9Z,12Z,15Z)/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/18:4(6Z,9Z,12Z,15Z)/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/18:4(6Z,9Z,12Z,15Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/18:4(6Z,9Z,12Z,15Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/18:4(6Z,9Z,12Z,15Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/18:4(6Z,9Z,12Z,15Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/18:4(6Z,9Z,12Z,15Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/18:4(6Z,9Z,12Z,15Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/18:4(6Z,9Z,12Z,15Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/18:4(6Z,9Z,12Z,15Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/18:4(6Z,9Z,12Z,15Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/18:4(6Z,9Z,12Z,15Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/18:4(6Z,9Z,12Z,15Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/20:0/20:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/20:0/20:1(11Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/20:0/20:2(11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/20:0/20:3(5Z,8Z,11Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/20:0/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/20:0/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/20:0/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/20:0/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/20:0/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/20:0/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/20:0/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/20:0/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/20:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/20:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/20:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/20:0/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/20:0/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/20:1(11Z)/20:1(11Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/20:1(11Z)/20:2(11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/20:1(11Z)/20:3(5Z,8Z,11Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/20:1(11Z)/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/20:1(11Z)/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/20:1(11Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/20:1(11Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/20:1(11Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/20:1(11Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/20:1(11Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/20:1(11Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/20:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/20:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/20:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/20:1(11Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/20:1(11Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/20:2(11Z,14Z)/20:2(11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/20:2(11Z,14Z)/20:3(5Z,8Z,11Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/20:2(11Z,14Z)/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/20:2(11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/20:2(11Z,14Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/20:2(11Z,14Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/20:2(11Z,14Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/20:2(11Z,14Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/20:2(11Z,14Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/20:2(11Z,14Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/20:2(11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/20:2(11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/20:2(11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/20:2(11Z,14Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/20:2(11Z,14Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/20:3(5Z,8Z,11Z)/20:3(5Z,8Z,11Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/20:3(5Z,8Z,11Z)/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/20:3(5Z,8Z,11Z)/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/20:3(5Z,8Z,11Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/20:3(5Z,8Z,11Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/20:3(5Z,8Z,11Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/20:3(5Z,8Z,11Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/20:3(5Z,8Z,11Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/20:3(5Z,8Z,11Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/20:3(5Z,8Z,11Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/20:3(5Z,8Z,11Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/20:3(5Z,8Z,11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/20:3(5Z,8Z,11Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/20:3(5Z,8Z,11Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/20:3(8Z,11Z,14Z)/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/20:3(8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/20:3(8Z,11Z,14Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/20:3(8Z,11Z,14Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/20:3(8Z,11Z,14Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/20:3(8Z,11Z,14Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/20:3(8Z,11Z,14Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/20:3(8Z,11Z,14Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/20:3(8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/20:3(8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/20:3(8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/20:3(8Z,11Z,14Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/20:3(8Z,11Z,14Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/20:4(5Z,8Z,11Z,14Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/20:4(5Z,8Z,11Z,14Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/20:4(5Z,8Z,11Z,14Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/20:4(5Z,8Z,11Z,14Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/20:4(5Z,8Z,11Z,14Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/20:4(5Z,8Z,11Z,14Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/20:4(5Z,8Z,11Z,14Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/20:4(5Z,8Z,11Z,14Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/20:4(8Z,11Z,14Z,17Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/20:4(8Z,11Z,14Z,17Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/20:4(8Z,11Z,14Z,17Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/20:4(8Z,11Z,14Z,17Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/20:4(8Z,11Z,14Z,17Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/20:4(8Z,11Z,14Z,17Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/20:4(8Z,11Z,14Z,17Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/20:4(8Z,11Z,14Z,17Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/20:4(8Z,11Z,14Z,17Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/20:4(8Z,11Z,14Z,17Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/20:4(8Z,11Z,14Z,17Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/20:5(5Z,8Z,11Z,14Z,17Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/20:5(5Z,8Z,11Z,14Z,17Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/20:5(5Z,8Z,11Z,14Z,17Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/20:5(5Z,8Z,11Z,14Z,17Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/20:5(5Z,8Z,11Z,14Z,17Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/20:5(5Z,8Z,11Z,14Z,17Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/20:5(5Z,8Z,11Z,14Z,17Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/20:5(5Z,8Z,11Z,14Z,17Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/20:5(5Z,8Z,11Z,14Z,17Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/20:5(5Z,8Z,11Z,14Z,17Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/22:0/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/22:0/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/22:0/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/22:0/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/22:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/22:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/22:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/22:0/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/22:0/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/22:1(13Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/22:1(13Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/22:1(13Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/22:1(13Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/22:1(13Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/22:1(13Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/22:1(13Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/22:1(13Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/22:2(13Z,16Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/22:2(13Z,16Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/22:2(13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/22:2(13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/22:2(13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/22:2(13Z,16Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/22:2(13Z,16Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/22:4(7Z,10Z,13Z,16Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/22:4(7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/22:4(7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/22:4(7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/22:4(7Z,10Z,13Z,16Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/22:4(7Z,10Z,13Z,16Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/24:0/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/24:0/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(6Z,9Z,12Z)/24:1(15Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/18:3(9Z,12Z,15Z)/18:3(9Z,12Z,15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/18:3(9Z,12Z,15Z)/18:4(6Z,9Z,12Z,15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/18:3(9Z,12Z,15Z)/20:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/18:3(9Z,12Z,15Z)/20:1(11Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/18:3(9Z,12Z,15Z)/20:2(11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/18:3(9Z,12Z,15Z)/20:3(5Z,8Z,11Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/18:3(9Z,12Z,15Z)/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/18:3(9Z,12Z,15Z)/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/18:3(9Z,12Z,15Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/18:3(9Z,12Z,15Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/18:3(9Z,12Z,15Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/18:3(9Z,12Z,15Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/18:3(9Z,12Z,15Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/18:3(9Z,12Z,15Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/18:3(9Z,12Z,15Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/18:3(9Z,12Z,15Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/18:3(9Z,12Z,15Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/18:3(9Z,12Z,15Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/18:3(9Z,12Z,15Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/18:4(6Z,9Z,12Z,15Z)/18:4(6Z,9Z,12Z,15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/18:4(6Z,9Z,12Z,15Z)/20:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/18:4(6Z,9Z,12Z,15Z)/20:1(11Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/18:4(6Z,9Z,12Z,15Z)/20:2(11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/18:4(6Z,9Z,12Z,15Z)/20:3(5Z,8Z,11Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/18:4(6Z,9Z,12Z,15Z)/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/18:4(6Z,9Z,12Z,15Z)/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/18:4(6Z,9Z,12Z,15Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/18:4(6Z,9Z,12Z,15Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/18:4(6Z,9Z,12Z,15Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/18:4(6Z,9Z,12Z,15Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/18:4(6Z,9Z,12Z,15Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/18:4(6Z,9Z,12Z,15Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/18:4(6Z,9Z,12Z,15Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/18:4(6Z,9Z,12Z,15Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/18:4(6Z,9Z,12Z,15Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/18:4(6Z,9Z,12Z,15Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/18:4(6Z,9Z,12Z,15Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/20:0/20:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/20:0/20:1(11Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/20:0/20:2(11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/20:0/20:3(5Z,8Z,11Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/20:0/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/20:0/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/20:0/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/20:0/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/20:0/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/20:0/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/20:0/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/20:0/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/20:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/20:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/20:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/20:0/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/20:0/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/20:1(11Z)/20:1(11Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/20:1(11Z)/20:2(11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/20:1(11Z)/20:3(5Z,8Z,11Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/20:1(11Z)/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/20:1(11Z)/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/20:1(11Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/20:1(11Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/20:1(11Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/20:1(11Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/20:1(11Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/20:1(11Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/20:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/20:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/20:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/20:1(11Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/20:1(11Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/20:2(11Z,14Z)/20:2(11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/20:2(11Z,14Z)/20:3(5Z,8Z,11Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/20:2(11Z,14Z)/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/20:2(11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/20:2(11Z,14Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/20:2(11Z,14Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/20:2(11Z,14Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/20:2(11Z,14Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/20:2(11Z,14Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/20:2(11Z,14Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/20:2(11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/20:2(11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/20:2(11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/20:2(11Z,14Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/20:2(11Z,14Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/20:3(5Z,8Z,11Z)/20:3(5Z,8Z,11Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/20:3(5Z,8Z,11Z)/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/20:3(5Z,8Z,11Z)/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/20:3(5Z,8Z,11Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/20:3(5Z,8Z,11Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/20:3(5Z,8Z,11Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/20:3(5Z,8Z,11Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/20:3(5Z,8Z,11Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/20:3(5Z,8Z,11Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/20:3(5Z,8Z,11Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/20:3(5Z,8Z,11Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/20:3(5Z,8Z,11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/20:3(5Z,8Z,11Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/20:3(5Z,8Z,11Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/20:3(8Z,11Z,14Z)/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/20:3(8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/20:3(8Z,11Z,14Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/20:3(8Z,11Z,14Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/20:3(8Z,11Z,14Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/20:3(8Z,11Z,14Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/20:3(8Z,11Z,14Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/20:3(8Z,11Z,14Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/20:3(8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/20:3(8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/20:3(8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/20:3(8Z,11Z,14Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/20:3(8Z,11Z,14Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/20:4(5Z,8Z,11Z,14Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/20:4(5Z,8Z,11Z,14Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/20:4(5Z,8Z,11Z,14Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/20:4(5Z,8Z,11Z,14Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/20:4(5Z,8Z,11Z,14Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/20:4(5Z,8Z,11Z,14Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/20:4(5Z,8Z,11Z,14Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/20:4(5Z,8Z,11Z,14Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/20:4(8Z,11Z,14Z,17Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/20:4(8Z,11Z,14Z,17Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/20:4(8Z,11Z,14Z,17Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/20:4(8Z,11Z,14Z,17Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/20:4(8Z,11Z,14Z,17Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/20:4(8Z,11Z,14Z,17Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/20:4(8Z,11Z,14Z,17Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/20:4(8Z,11Z,14Z,17Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/20:4(8Z,11Z,14Z,17Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/20:4(8Z,11Z,14Z,17Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/20:4(8Z,11Z,14Z,17Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/20:5(5Z,8Z,11Z,14Z,17Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/20:5(5Z,8Z,11Z,14Z,17Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/20:5(5Z,8Z,11Z,14Z,17Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/20:5(5Z,8Z,11Z,14Z,17Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/20:5(5Z,8Z,11Z,14Z,17Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/20:5(5Z,8Z,11Z,14Z,17Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/20:5(5Z,8Z,11Z,14Z,17Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/20:5(5Z,8Z,11Z,14Z,17Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/20:5(5Z,8Z,11Z,14Z,17Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/20:5(5Z,8Z,11Z,14Z,17Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/22:0/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/22:0/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/22:0/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/22:0/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/22:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/22:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/22:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/22:0/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/22:0/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/22:1(13Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/22:1(13Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/22:1(13Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/22:1(13Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/22:1(13Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/22:1(13Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/22:1(13Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/22:1(13Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/22:2(13Z,16Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/22:2(13Z,16Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/22:2(13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/22:2(13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/22:2(13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/22:2(13Z,16Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/22:2(13Z,16Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/22:4(7Z,10Z,13Z,16Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/22:4(7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/22:4(7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/22:4(7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/22:4(7Z,10Z,13Z,16Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/22:4(7Z,10Z,13Z,16Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/22:5(4Z,7Z,10Z,13Z,16Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/22:5(4Z,7Z,10Z,13Z,16Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/22:5(7Z,10Z,13Z,16Z,19Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/22:5(7Z,10Z,13Z,16Z,19Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/24:0/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/24:0/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:3(9Z,12Z,15Z)/24:1(15Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/18:4(6Z,9Z,12Z,15Z)/18:4(6Z,9Z,12Z,15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/18:4(6Z,9Z,12Z,15Z)/20:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/18:4(6Z,9Z,12Z,15Z)/20:1(11Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/18:4(6Z,9Z,12Z,15Z)/20:2(11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/18:4(6Z,9Z,12Z,15Z)/20:3(5Z,8Z,11Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/18:4(6Z,9Z,12Z,15Z)/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/18:4(6Z,9Z,12Z,15Z)/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/18:4(6Z,9Z,12Z,15Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/18:4(6Z,9Z,12Z,15Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/18:4(6Z,9Z,12Z,15Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/18:4(6Z,9Z,12Z,15Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/18:4(6Z,9Z,12Z,15Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/18:4(6Z,9Z,12Z,15Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/18:4(6Z,9Z,12Z,15Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/18:4(6Z,9Z,12Z,15Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/18:4(6Z,9Z,12Z,15Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/18:4(6Z,9Z,12Z,15Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/18:4(6Z,9Z,12Z,15Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/20:0/20:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/20:0/20:1(11Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/20:0/20:2(11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/20:0/20:3(5Z,8Z,11Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/20:0/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/20:0/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/20:0/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/20:0/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/20:0/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/20:0/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/20:0/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/20:0/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/20:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/20:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/20:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/20:0/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/20:0/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/20:1(11Z)/20:1(11Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/20:1(11Z)/20:2(11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/20:1(11Z)/20:3(5Z,8Z,11Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/20:1(11Z)/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/20:1(11Z)/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/20:1(11Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/20:1(11Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/20:1(11Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/20:1(11Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/20:1(11Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/20:1(11Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/20:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/20:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/20:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/20:1(11Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/20:1(11Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/20:2(11Z,14Z)/20:2(11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/20:2(11Z,14Z)/20:3(5Z,8Z,11Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/20:2(11Z,14Z)/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/20:2(11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/20:2(11Z,14Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/20:2(11Z,14Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/20:2(11Z,14Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/20:2(11Z,14Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/20:2(11Z,14Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/20:2(11Z,14Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/20:2(11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/20:2(11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/20:2(11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/20:2(11Z,14Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/20:2(11Z,14Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/20:3(5Z,8Z,11Z)/20:3(5Z,8Z,11Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/20:3(5Z,8Z,11Z)/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/20:3(5Z,8Z,11Z)/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/20:3(5Z,8Z,11Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/20:3(5Z,8Z,11Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/20:3(5Z,8Z,11Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/20:3(5Z,8Z,11Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/20:3(5Z,8Z,11Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/20:3(5Z,8Z,11Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/20:3(5Z,8Z,11Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/20:3(5Z,8Z,11Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/20:3(5Z,8Z,11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/20:3(5Z,8Z,11Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/20:3(5Z,8Z,11Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/20:3(8Z,11Z,14Z)/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/20:3(8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/20:3(8Z,11Z,14Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/20:3(8Z,11Z,14Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/20:3(8Z,11Z,14Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/20:3(8Z,11Z,14Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/20:3(8Z,11Z,14Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/20:3(8Z,11Z,14Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/20:3(8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/20:3(8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/20:3(8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/20:3(8Z,11Z,14Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/20:3(8Z,11Z,14Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/20:4(5Z,8Z,11Z,14Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/20:4(5Z,8Z,11Z,14Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/20:4(5Z,8Z,11Z,14Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/20:4(5Z,8Z,11Z,14Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/20:4(5Z,8Z,11Z,14Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/20:4(5Z,8Z,11Z,14Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/20:4(5Z,8Z,11Z,14Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/20:4(5Z,8Z,11Z,14Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/20:4(8Z,11Z,14Z,17Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/20:4(8Z,11Z,14Z,17Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/20:4(8Z,11Z,14Z,17Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/20:4(8Z,11Z,14Z,17Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/20:4(8Z,11Z,14Z,17Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/20:4(8Z,11Z,14Z,17Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/20:4(8Z,11Z,14Z,17Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/20:4(8Z,11Z,14Z,17Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/20:4(8Z,11Z,14Z,17Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/20:4(8Z,11Z,14Z,17Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/20:4(8Z,11Z,14Z,17Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/20:5(5Z,8Z,11Z,14Z,17Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/20:5(5Z,8Z,11Z,14Z,17Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/20:5(5Z,8Z,11Z,14Z,17Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/20:5(5Z,8Z,11Z,14Z,17Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/20:5(5Z,8Z,11Z,14Z,17Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/20:5(5Z,8Z,11Z,14Z,17Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/20:5(5Z,8Z,11Z,14Z,17Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/20:5(5Z,8Z,11Z,14Z,17Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/20:5(5Z,8Z,11Z,14Z,17Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/20:5(5Z,8Z,11Z,14Z,17Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/22:0/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/22:0/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/22:0/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/22:0/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/22:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/22:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/22:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/22:0/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/22:0/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/22:1(13Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/22:1(13Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/22:1(13Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/22:1(13Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/22:1(13Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/22:1(13Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/22:1(13Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/22:1(13Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/22:2(13Z,16Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/22:2(13Z,16Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/22:2(13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/22:2(13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/22:2(13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/22:2(13Z,16Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/22:2(13Z,16Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/22:4(7Z,10Z,13Z,16Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/22:4(7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/22:4(7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/22:4(7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/22:4(7Z,10Z,13Z,16Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/22:4(7Z,10Z,13Z,16Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/22:5(4Z,7Z,10Z,13Z,16Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/22:5(4Z,7Z,10Z,13Z,16Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/22:5(7Z,10Z,13Z,16Z,19Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/22:5(7Z,10Z,13Z,16Z,19Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/24:0/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/24:0/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(18:4(6Z,9Z,12Z,15Z)/24:1(15Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(19:0/19:0/20:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/19:0/21:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/19:0/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/19:0/a-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/19:0/a-25:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/19:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/19:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/19:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/20:0/21:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/20:0/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/20:0/a-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/20:0/a-25:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/20:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/20:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/20:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/20:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/20:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/21:0/10:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/21:0/12:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/21:0/13:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/21:0/14:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/21:0/15:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/21:0/16:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/21:0/17:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/21:0/18:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/21:0/21:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/21:0/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/21:0/8:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/21:0/a-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/21:0/a-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/21:0/a-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/21:0/a-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/21:0/a-25:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/21:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/21:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/21:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/21:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/21:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/21:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/21:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/21:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/21:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/21:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/21:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/21:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/22:0/10:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/22:0/12:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/22:0/13:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/22:0/14:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/22:0/15:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/22:0/16:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/22:0/17:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/22:0/18:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/22:0/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/22:0/8:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/22:0/a-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/22:0/a-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/22:0/a-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/22:0/a-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/22:0/a-25:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/22:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/22:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/22:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/22:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/22:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/22:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/22:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/22:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/22:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/22:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/22:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/22:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/a-21:0/12:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/a-21:0/13:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/a-21:0/14:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/a-21:0/15:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/a-21:0/16:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/a-21:0/17:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/a-21:0/18:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/a-21:0/8:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/a-21:0/a-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/a-21:0/a-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/a-21:0/a-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/a-21:0/a-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/a-21:0/a-25:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/a-21:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/a-21:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/a-21:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/a-21:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/a-21:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/a-21:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/a-21:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/a-21:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/a-21:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/a-21:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/a-21:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/a-21:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/a-25:0/12:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/a-25:0/13:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/a-25:0/14:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/a-25:0/15:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/a-25:0/16:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/a-25:0/17:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/a-25:0/18:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/a-25:0/8:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/a-25:0/a-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/a-25:0/a-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/a-25:0/a-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/a-25:0/a-25:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/a-25:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/a-25:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/a-25:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/a-25:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/a-25:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/a-25:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/a-25:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/a-25:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/a-25:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/a-25:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/a-25:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/a-25:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/i-20:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/i-20:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/i-20:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/i-20:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/i-21:0/12:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/i-21:0/13:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/i-21:0/14:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/i-21:0/15:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/i-21:0/16:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/i-21:0/17:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/i-21:0/18:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/i-21:0/8:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/i-21:0/a-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/i-21:0/a-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/i-21:0/a-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/i-21:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/i-21:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/i-21:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/i-21:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/i-21:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/i-21:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/i-21:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/i-21:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/i-21:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/i-21:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/i-21:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/i-22:0/12:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/i-22:0/13:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/i-22:0/14:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/i-22:0/15:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/i-22:0/16:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/i-22:0/17:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/i-22:0/18:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/i-22:0/8:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/i-22:0/a-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/i-22:0/a-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/i-22:0/a-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/i-22:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/i-22:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/i-22:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/i-22:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/i-22:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/i-22:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/i-22:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/i-22:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/i-22:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/i-22:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/i-24:0/12:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/i-24:0/13:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/i-24:0/14:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/i-24:0/15:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/i-24:0/16:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/i-24:0/17:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/i-24:0/18:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/i-24:0/8:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/i-24:0/a-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/i-24:0/a-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/i-24:0/a-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/i-24:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/i-24:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/i-24:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/i-24:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/i-24:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/i-24:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/i-24:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/i-24:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(19:0/i-24:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/10:0/10:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/10:0/14:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/10:0/17:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/10:0/19:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/10:0/21:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/10:0/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/12:0/10:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/12:0/12:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/12:0/13:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/12:0/16:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/12:0/17:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/12:0/18:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/12:0/19:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/12:0/21:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/12:0/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/12:0/8:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/12:0/a-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/12:0/a-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/12:0/a-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/12:0/a-25:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/12:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/12:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/12:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/12:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/12:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/12:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/12:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/12:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/12:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/12:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/12:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/12:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/13:0/10:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/13:0/13:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/13:0/15:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/13:0/16:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/13:0/21:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/13:0/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/13:0/8:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/13:0/a-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/13:0/a-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/13:0/a-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/13:0/a-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/13:0/a-25:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/13:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/13:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/13:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/13:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/13:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/13:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/13:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/13:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/13:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/13:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/13:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/13:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/14:0/12:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/14:0/13:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/14:0/19:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/14:0/21:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/14:0/a-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/14:0/a-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/14:0/a-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/14:0/a-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/14:0/a-25:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/14:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/14:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/14:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/14:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/14:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/14:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/14:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/14:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/14:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/14:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/14:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/14:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/15:0/10:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/15:0/12:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/15:0/17:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/15:0/21:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/15:0/a-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/15:0/a-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/15:0/a-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/15:0/a-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/15:0/a-25:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/15:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/15:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/15:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/15:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/15:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/15:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/15:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/15:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/15:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/15:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/15:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/15:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/16:0/10:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/16:0/19:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/16:0/21:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/16:0/a-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/16:0/a-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/16:0/a-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/16:0/a-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/16:0/a-25:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/16:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/16:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/16:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/16:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/16:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/16:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/16:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/16:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/16:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/16:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/16:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/16:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/17:0/13:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/17:0/14:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/17:0/16:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/17:0/17:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/17:0/19:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/17:0/21:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/17:0/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/17:0/8:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/17:0/a-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/17:0/a-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/17:0/a-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/17:0/a-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/17:0/a-25:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/17:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/17:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/17:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/17:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/17:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/17:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/17:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/17:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/17:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/17:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/17:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/17:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/18:0/10:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/18:0/13:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/18:0/17:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/18:0/21:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/18:0/8:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/18:0/a-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/18:0/a-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/18:0/a-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/18:0/a-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/18:0/a-25:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/18:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/18:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/18:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/18:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/18:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/18:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/18:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/18:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/18:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/18:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/18:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/18:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/19:0/13:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/19:0/15:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/19:0/18:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/19:0/a-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/19:0/a-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/19:0/a-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/19:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/19:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/19:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/19:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/19:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/19:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/19:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/20:0/10:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/20:0/12:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/20:0/13:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/20:0/17:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/20:0/19:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/20:0/20:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/20:0/20:1(11Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:0/20:0/20:2(11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:0/20:0/20:3(5Z,8Z,11Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:0/20:0/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:0/20:0/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:0/20:0/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:0/20:0/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:0/20:0/21:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/20:0/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/20:0/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:0/20:0/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:0/20:0/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:0/20:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:0/20:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:0/20:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:0/20:0/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/20:0/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:0/20:0/8:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/20:0/a-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/20:0/a-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/20:0/a-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/20:0/a-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/20:0/a-25:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/20:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/20:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/20:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/20:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/20:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/20:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/20:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/20:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/20:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/20:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/20:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/20:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/20:1(11Z)/20:1(11Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:0/20:1(11Z)/20:2(11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:0/20:1(11Z)/20:3(5Z,8Z,11Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:0/20:1(11Z)/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:0/20:1(11Z)/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:0/20:1(11Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:0/20:1(11Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:0/20:1(11Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/20:1(11Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:0/20:1(11Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:0/20:1(11Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:0/20:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:0/20:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:0/20:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:0/20:1(11Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/20:1(11Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:0/20:2(11Z,14Z)/20:2(11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:0/20:2(11Z,14Z)/20:3(5Z,8Z,11Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:0/20:2(11Z,14Z)/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:0/20:2(11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:0/20:2(11Z,14Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:0/20:2(11Z,14Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:0/20:2(11Z,14Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/20:2(11Z,14Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:0/20:2(11Z,14Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:0/20:2(11Z,14Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:0/20:2(11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:0/20:2(11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:0/20:2(11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:0/20:2(11Z,14Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/20:2(11Z,14Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:0/20:3(5Z,8Z,11Z)/20:3(5Z,8Z,11Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:0/20:3(5Z,8Z,11Z)/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:0/20:3(5Z,8Z,11Z)/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:0/20:3(5Z,8Z,11Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:0/20:3(5Z,8Z,11Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:0/20:3(5Z,8Z,11Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/20:3(5Z,8Z,11Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:0/20:3(5Z,8Z,11Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:0/20:3(5Z,8Z,11Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:0/20:3(5Z,8Z,11Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:0/20:3(5Z,8Z,11Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:0/20:3(5Z,8Z,11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:0/20:3(5Z,8Z,11Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/20:3(5Z,8Z,11Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:0/20:3(8Z,11Z,14Z)/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:0/20:3(8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:0/20:3(8Z,11Z,14Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:0/20:3(8Z,11Z,14Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:0/20:3(8Z,11Z,14Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/20:3(8Z,11Z,14Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:0/20:3(8Z,11Z,14Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:0/20:3(8Z,11Z,14Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:0/20:3(8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:0/20:3(8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:0/20:3(8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:0/20:3(8Z,11Z,14Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/20:3(8Z,11Z,14Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:0/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:0/20:4(5Z,8Z,11Z,14Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:0/20:4(5Z,8Z,11Z,14Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:0/20:4(5Z,8Z,11Z,14Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/20:4(5Z,8Z,11Z,14Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:0/20:4(5Z,8Z,11Z,14Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:0/20:4(5Z,8Z,11Z,14Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:0/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:0/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:0/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:0/20:4(5Z,8Z,11Z,14Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/20:4(5Z,8Z,11Z,14Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:0/20:4(8Z,11Z,14Z,17Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:0/20:4(8Z,11Z,14Z,17Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:0/20:4(8Z,11Z,14Z,17Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/20:4(8Z,11Z,14Z,17Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:0/20:4(8Z,11Z,14Z,17Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:0/20:4(8Z,11Z,14Z,17Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:0/20:4(8Z,11Z,14Z,17Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:0/20:4(8Z,11Z,14Z,17Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:0/20:4(8Z,11Z,14Z,17Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:0/20:4(8Z,11Z,14Z,17Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/20:4(8Z,11Z,14Z,17Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:0/20:5(5Z,8Z,11Z,14Z,17Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:0/20:5(5Z,8Z,11Z,14Z,17Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/20:5(5Z,8Z,11Z,14Z,17Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:0/20:5(5Z,8Z,11Z,14Z,17Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:0/20:5(5Z,8Z,11Z,14Z,17Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:0/20:5(5Z,8Z,11Z,14Z,17Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:0/20:5(5Z,8Z,11Z,14Z,17Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:0/20:5(5Z,8Z,11Z,14Z,17Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:0/20:5(5Z,8Z,11Z,14Z,17Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/20:5(5Z,8Z,11Z,14Z,17Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:0/21:0/21:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/21:0/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/21:0/a-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/21:0/a-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/21:0/a-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/21:0/a-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/21:0/a-25:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/21:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/21:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/21:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/21:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/21:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/21:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/21:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/21:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/21:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/21:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/21:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/21:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/22:0/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/22:0/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:0/22:0/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:0/22:0/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:0/22:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:0/22:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:0/22:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:0/22:0/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/22:0/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:0/22:0/a-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/22:0/a-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/22:0/a-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/22:0/a-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/22:0/a-25:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/22:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/22:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/22:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/22:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/22:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/22:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/22:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/22:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/22:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/22:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/22:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/22:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/22:1(13Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:0/22:1(13Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:0/22:1(13Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:0/22:1(13Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:0/22:1(13Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:0/22:1(13Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:0/22:1(13Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/22:1(13Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:0/22:2(13Z,16Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:0/22:2(13Z,16Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:0/22:2(13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:0/22:2(13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:0/22:2(13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:0/22:2(13Z,16Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/22:2(13Z,16Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:0/22:4(7Z,10Z,13Z,16Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:0/22:4(7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:0/22:4(7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:0/22:4(7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:0/22:4(7Z,10Z,13Z,16Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/22:4(7Z,10Z,13Z,16Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:0/22:5(4Z,7Z,10Z,13Z,16Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/22:5(4Z,7Z,10Z,13Z,16Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:0/22:5(7Z,10Z,13Z,16Z,19Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/22:5(7Z,10Z,13Z,16Z,19Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:0/24:0/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/24:0/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:0/24:1(15Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:0/8:0/10:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/8:0/14:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/8:0/15:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/8:0/16:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/8:0/19:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/8:0/21:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/8:0/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/8:0/8:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/8:0/a-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/8:0/a-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/8:0/a-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/8:0/a-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/8:0/a-25:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/8:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/8:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/8:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/8:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/8:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/8:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/8:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/8:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/8:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/8:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/8:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/8:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/a-13:0/a-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/a-13:0/a-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/a-13:0/a-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/a-13:0/a-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/a-13:0/a-25:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/a-13:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/a-13:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/a-13:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/a-13:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/a-13:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/a-13:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/a-13:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/a-13:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/a-13:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/a-13:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/a-13:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/a-13:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/a-15:0/a-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/a-15:0/a-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/a-15:0/a-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/a-15:0/a-25:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/a-15:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/a-15:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/a-15:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/a-15:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/a-15:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/a-15:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/a-15:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/a-15:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/a-15:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/a-15:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/a-15:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/a-15:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/a-17:0/a-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/a-17:0/a-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/a-17:0/a-25:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/a-17:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/a-17:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/a-17:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/a-17:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/a-17:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/a-17:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/a-17:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/a-17:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/a-17:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/a-17:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/a-17:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/a-17:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/a-21:0/12:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/a-21:0/a-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/a-21:0/a-25:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/a-21:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/a-21:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/a-21:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/a-21:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/a-21:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/a-21:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/a-21:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/a-21:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/a-21:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/a-21:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/a-21:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/a-21:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/a-25:0/a-25:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/a-25:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/a-25:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/a-25:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/a-25:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/a-25:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/a-25:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/a-25:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/a-25:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/a-25:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/a-25:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/a-25:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/a-25:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/i-12:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/i-12:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/i-12:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/i-12:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/i-12:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/i-12:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/i-12:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/i-12:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/i-12:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/i-12:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/i-12:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/i-12:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/i-13:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/i-13:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/i-13:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/i-13:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/i-13:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/i-13:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/i-13:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/i-13:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/i-13:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/i-13:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/i-13:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/i-14:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/i-14:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/i-14:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/i-14:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/i-14:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/i-14:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/i-14:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/i-14:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/i-14:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/i-14:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/i-15:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/i-15:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/i-15:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/i-15:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/i-15:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/i-15:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/i-15:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/i-15:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/i-15:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/i-16:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/i-16:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/i-16:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/i-16:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/i-16:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/i-16:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/i-16:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/i-16:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/i-17:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/i-17:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/i-17:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/i-17:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/i-17:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/i-17:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/i-17:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/i-18:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/i-18:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/i-18:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/i-18:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/i-18:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/i-18:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/i-19:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/i-19:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/i-19:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/i-19:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/i-19:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/i-20:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/i-20:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/i-20:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/i-20:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/i-21:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/i-21:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/i-21:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/i-22:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/i-22:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:0/i-24:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:1(11Z)/20:1(11Z)/20:1(11Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:1(11Z)/20:1(11Z)/20:2(11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:1(11Z)/20:1(11Z)/20:3(5Z,8Z,11Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:1(11Z)/20:1(11Z)/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:1(11Z)/20:1(11Z)/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:1(11Z)/20:1(11Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:1(11Z)/20:1(11Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:1(11Z)/20:1(11Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:1(11Z)/20:1(11Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:1(11Z)/20:1(11Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:1(11Z)/20:1(11Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:1(11Z)/20:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:1(11Z)/20:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:1(11Z)/20:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:1(11Z)/20:1(11Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:1(11Z)/20:1(11Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:1(11Z)/20:2(11Z,14Z)/20:2(11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:1(11Z)/20:2(11Z,14Z)/20:3(5Z,8Z,11Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:1(11Z)/20:2(11Z,14Z)/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:1(11Z)/20:2(11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:1(11Z)/20:2(11Z,14Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:1(11Z)/20:2(11Z,14Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:1(11Z)/20:2(11Z,14Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:1(11Z)/20:2(11Z,14Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:1(11Z)/20:2(11Z,14Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:1(11Z)/20:2(11Z,14Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:1(11Z)/20:2(11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:1(11Z)/20:2(11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:1(11Z)/20:2(11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:1(11Z)/20:2(11Z,14Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:1(11Z)/20:2(11Z,14Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:1(11Z)/20:3(5Z,8Z,11Z)/20:3(5Z,8Z,11Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:1(11Z)/20:3(5Z,8Z,11Z)/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:1(11Z)/20:3(5Z,8Z,11Z)/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:1(11Z)/20:3(5Z,8Z,11Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:1(11Z)/20:3(5Z,8Z,11Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:1(11Z)/20:3(5Z,8Z,11Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:1(11Z)/20:3(5Z,8Z,11Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:1(11Z)/20:3(5Z,8Z,11Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:1(11Z)/20:3(5Z,8Z,11Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:1(11Z)/20:3(5Z,8Z,11Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:1(11Z)/20:3(5Z,8Z,11Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:1(11Z)/20:3(5Z,8Z,11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:1(11Z)/20:3(5Z,8Z,11Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:1(11Z)/20:3(5Z,8Z,11Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:1(11Z)/20:3(8Z,11Z,14Z)/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:1(11Z)/20:3(8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:1(11Z)/20:3(8Z,11Z,14Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:1(11Z)/20:3(8Z,11Z,14Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:1(11Z)/20:3(8Z,11Z,14Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:1(11Z)/20:3(8Z,11Z,14Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:1(11Z)/20:3(8Z,11Z,14Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:1(11Z)/20:3(8Z,11Z,14Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:1(11Z)/20:3(8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:1(11Z)/20:3(8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:1(11Z)/20:3(8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:1(11Z)/20:3(8Z,11Z,14Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:1(11Z)/20:3(8Z,11Z,14Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:1(11Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:1(11Z)/20:4(5Z,8Z,11Z,14Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:1(11Z)/20:4(5Z,8Z,11Z,14Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:1(11Z)/20:4(5Z,8Z,11Z,14Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:1(11Z)/20:4(5Z,8Z,11Z,14Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:1(11Z)/20:4(5Z,8Z,11Z,14Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:1(11Z)/20:4(5Z,8Z,11Z,14Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:1(11Z)/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:1(11Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:1(11Z)/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:1(11Z)/20:4(5Z,8Z,11Z,14Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:1(11Z)/20:4(5Z,8Z,11Z,14Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:1(11Z)/20:4(8Z,11Z,14Z,17Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:1(11Z)/20:4(8Z,11Z,14Z,17Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:1(11Z)/20:4(8Z,11Z,14Z,17Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:1(11Z)/20:4(8Z,11Z,14Z,17Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:1(11Z)/20:4(8Z,11Z,14Z,17Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:1(11Z)/20:4(8Z,11Z,14Z,17Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:1(11Z)/20:4(8Z,11Z,14Z,17Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:1(11Z)/20:4(8Z,11Z,14Z,17Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:1(11Z)/20:4(8Z,11Z,14Z,17Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:1(11Z)/20:4(8Z,11Z,14Z,17Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:1(11Z)/20:4(8Z,11Z,14Z,17Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:1(11Z)/20:5(5Z,8Z,11Z,14Z,17Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:1(11Z)/20:5(5Z,8Z,11Z,14Z,17Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:1(11Z)/20:5(5Z,8Z,11Z,14Z,17Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:1(11Z)/20:5(5Z,8Z,11Z,14Z,17Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:1(11Z)/20:5(5Z,8Z,11Z,14Z,17Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:1(11Z)/20:5(5Z,8Z,11Z,14Z,17Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:1(11Z)/20:5(5Z,8Z,11Z,14Z,17Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:1(11Z)/20:5(5Z,8Z,11Z,14Z,17Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:1(11Z)/20:5(5Z,8Z,11Z,14Z,17Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:1(11Z)/20:5(5Z,8Z,11Z,14Z,17Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:1(11Z)/22:0/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:1(11Z)/22:0/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:1(11Z)/22:0/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:1(11Z)/22:0/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:1(11Z)/22:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:1(11Z)/22:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:1(11Z)/22:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:1(11Z)/22:0/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:1(11Z)/22:0/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:1(11Z)/22:1(13Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:1(11Z)/22:1(13Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:1(11Z)/22:1(13Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:1(11Z)/22:1(13Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:1(11Z)/22:1(13Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:1(11Z)/22:1(13Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:1(11Z)/22:1(13Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:1(11Z)/22:1(13Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:1(11Z)/22:2(13Z,16Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:1(11Z)/22:2(13Z,16Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:1(11Z)/22:2(13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:1(11Z)/22:2(13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:1(11Z)/22:2(13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:1(11Z)/22:2(13Z,16Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:1(11Z)/22:2(13Z,16Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:1(11Z)/22:4(7Z,10Z,13Z,16Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:1(11Z)/22:4(7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:1(11Z)/22:4(7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:1(11Z)/22:4(7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:1(11Z)/22:4(7Z,10Z,13Z,16Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:1(11Z)/22:4(7Z,10Z,13Z,16Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:1(11Z)/24:0/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:1(11Z)/24:0/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:1(11Z)/24:1(15Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:2(11Z,14Z)/20:2(11Z,14Z)/20:2(11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:2(11Z,14Z)/20:2(11Z,14Z)/20:3(5Z,8Z,11Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:2(11Z,14Z)/20:2(11Z,14Z)/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:2(11Z,14Z)/20:2(11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:2(11Z,14Z)/20:2(11Z,14Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:2(11Z,14Z)/20:2(11Z,14Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:2(11Z,14Z)/20:2(11Z,14Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:2(11Z,14Z)/20:2(11Z,14Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:2(11Z,14Z)/20:2(11Z,14Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:2(11Z,14Z)/20:2(11Z,14Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:2(11Z,14Z)/20:2(11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:2(11Z,14Z)/20:2(11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:2(11Z,14Z)/20:2(11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:2(11Z,14Z)/20:2(11Z,14Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:2(11Z,14Z)/20:2(11Z,14Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:2(11Z,14Z)/20:3(5Z,8Z,11Z)/20:3(5Z,8Z,11Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:2(11Z,14Z)/20:3(5Z,8Z,11Z)/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:2(11Z,14Z)/20:3(5Z,8Z,11Z)/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:2(11Z,14Z)/20:3(5Z,8Z,11Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:2(11Z,14Z)/20:3(5Z,8Z,11Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:2(11Z,14Z)/20:3(5Z,8Z,11Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:2(11Z,14Z)/20:3(5Z,8Z,11Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:2(11Z,14Z)/20:3(5Z,8Z,11Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:2(11Z,14Z)/20:3(5Z,8Z,11Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:2(11Z,14Z)/20:3(5Z,8Z,11Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:2(11Z,14Z)/20:3(5Z,8Z,11Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:2(11Z,14Z)/20:3(5Z,8Z,11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:2(11Z,14Z)/20:3(5Z,8Z,11Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:2(11Z,14Z)/20:3(5Z,8Z,11Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:2(11Z,14Z)/20:3(8Z,11Z,14Z)/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:2(11Z,14Z)/20:3(8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:2(11Z,14Z)/20:3(8Z,11Z,14Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:2(11Z,14Z)/20:3(8Z,11Z,14Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:2(11Z,14Z)/20:3(8Z,11Z,14Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:2(11Z,14Z)/20:3(8Z,11Z,14Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:2(11Z,14Z)/20:3(8Z,11Z,14Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:2(11Z,14Z)/20:3(8Z,11Z,14Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:2(11Z,14Z)/20:3(8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:2(11Z,14Z)/20:3(8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:2(11Z,14Z)/20:3(8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:2(11Z,14Z)/20:3(8Z,11Z,14Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:2(11Z,14Z)/20:3(8Z,11Z,14Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:2(11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:2(11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:2(11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:2(11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:2(11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:2(11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:2(11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:2(11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:2(11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:2(11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:2(11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:2(11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:2(11Z,14Z)/20:4(8Z,11Z,14Z,17Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:2(11Z,14Z)/20:4(8Z,11Z,14Z,17Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:2(11Z,14Z)/20:4(8Z,11Z,14Z,17Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:2(11Z,14Z)/20:4(8Z,11Z,14Z,17Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:2(11Z,14Z)/20:4(8Z,11Z,14Z,17Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:2(11Z,14Z)/20:4(8Z,11Z,14Z,17Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:2(11Z,14Z)/20:4(8Z,11Z,14Z,17Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:2(11Z,14Z)/20:4(8Z,11Z,14Z,17Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:2(11Z,14Z)/20:4(8Z,11Z,14Z,17Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:2(11Z,14Z)/20:4(8Z,11Z,14Z,17Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:2(11Z,14Z)/20:4(8Z,11Z,14Z,17Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:2(11Z,14Z)/20:5(5Z,8Z,11Z,14Z,17Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:2(11Z,14Z)/20:5(5Z,8Z,11Z,14Z,17Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:2(11Z,14Z)/20:5(5Z,8Z,11Z,14Z,17Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:2(11Z,14Z)/20:5(5Z,8Z,11Z,14Z,17Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:2(11Z,14Z)/20:5(5Z,8Z,11Z,14Z,17Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:2(11Z,14Z)/20:5(5Z,8Z,11Z,14Z,17Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:2(11Z,14Z)/20:5(5Z,8Z,11Z,14Z,17Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:2(11Z,14Z)/20:5(5Z,8Z,11Z,14Z,17Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:2(11Z,14Z)/20:5(5Z,8Z,11Z,14Z,17Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:2(11Z,14Z)/20:5(5Z,8Z,11Z,14Z,17Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:2(11Z,14Z)/22:0/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:2(11Z,14Z)/22:0/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:2(11Z,14Z)/22:0/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:2(11Z,14Z)/22:0/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:2(11Z,14Z)/22:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:2(11Z,14Z)/22:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:2(11Z,14Z)/22:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:2(11Z,14Z)/22:0/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:2(11Z,14Z)/22:0/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:2(11Z,14Z)/22:1(13Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:2(11Z,14Z)/22:1(13Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:2(11Z,14Z)/22:1(13Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:2(11Z,14Z)/22:1(13Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:2(11Z,14Z)/22:1(13Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:2(11Z,14Z)/22:1(13Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:2(11Z,14Z)/22:1(13Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:2(11Z,14Z)/22:1(13Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:2(11Z,14Z)/22:2(13Z,16Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:2(11Z,14Z)/22:2(13Z,16Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:2(11Z,14Z)/22:2(13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:2(11Z,14Z)/22:2(13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:2(11Z,14Z)/22:2(13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:2(11Z,14Z)/22:2(13Z,16Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:2(11Z,14Z)/22:2(13Z,16Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:2(11Z,14Z)/22:4(7Z,10Z,13Z,16Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:2(11Z,14Z)/22:4(7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:2(11Z,14Z)/22:4(7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:2(11Z,14Z)/22:4(7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:2(11Z,14Z)/22:4(7Z,10Z,13Z,16Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:2(11Z,14Z)/22:4(7Z,10Z,13Z,16Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:2(11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:2(11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:2(11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:2(11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:2(11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:2(11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:2(11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:2(11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:2(11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:2(11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:2(11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:2(11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:2(11Z,14Z)/24:0/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:2(11Z,14Z)/24:0/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:2(11Z,14Z)/24:1(15Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(5Z,8Z,11Z)/20:3(5Z,8Z,11Z)/20:3(5Z,8Z,11Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(5Z,8Z,11Z)/20:3(5Z,8Z,11Z)/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(5Z,8Z,11Z)/20:3(5Z,8Z,11Z)/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(5Z,8Z,11Z)/20:3(5Z,8Z,11Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(5Z,8Z,11Z)/20:3(5Z,8Z,11Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(5Z,8Z,11Z)/20:3(5Z,8Z,11Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:3(5Z,8Z,11Z)/20:3(5Z,8Z,11Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(5Z,8Z,11Z)/20:3(5Z,8Z,11Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(5Z,8Z,11Z)/20:3(5Z,8Z,11Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(5Z,8Z,11Z)/20:3(5Z,8Z,11Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(5Z,8Z,11Z)/20:3(5Z,8Z,11Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(5Z,8Z,11Z)/20:3(5Z,8Z,11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(5Z,8Z,11Z)/20:3(5Z,8Z,11Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:3(5Z,8Z,11Z)/20:3(5Z,8Z,11Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(5Z,8Z,11Z)/20:3(8Z,11Z,14Z)/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(5Z,8Z,11Z)/20:3(8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(5Z,8Z,11Z)/20:3(8Z,11Z,14Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(5Z,8Z,11Z)/20:3(8Z,11Z,14Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(5Z,8Z,11Z)/20:3(8Z,11Z,14Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:3(5Z,8Z,11Z)/20:3(8Z,11Z,14Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(5Z,8Z,11Z)/20:3(8Z,11Z,14Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(5Z,8Z,11Z)/20:3(8Z,11Z,14Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(5Z,8Z,11Z)/20:3(8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(5Z,8Z,11Z)/20:3(8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(5Z,8Z,11Z)/20:3(8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(5Z,8Z,11Z)/20:3(8Z,11Z,14Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:3(5Z,8Z,11Z)/20:3(8Z,11Z,14Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(5Z,8Z,11Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(5Z,8Z,11Z)/20:4(5Z,8Z,11Z,14Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(5Z,8Z,11Z)/20:4(5Z,8Z,11Z,14Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(5Z,8Z,11Z)/20:4(5Z,8Z,11Z,14Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:3(5Z,8Z,11Z)/20:4(5Z,8Z,11Z,14Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(5Z,8Z,11Z)/20:4(5Z,8Z,11Z,14Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(5Z,8Z,11Z)/20:4(5Z,8Z,11Z,14Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(5Z,8Z,11Z)/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(5Z,8Z,11Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(5Z,8Z,11Z)/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(5Z,8Z,11Z)/20:4(5Z,8Z,11Z,14Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:3(5Z,8Z,11Z)/20:4(5Z,8Z,11Z,14Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(5Z,8Z,11Z)/20:4(8Z,11Z,14Z,17Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(5Z,8Z,11Z)/20:4(8Z,11Z,14Z,17Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(5Z,8Z,11Z)/20:4(8Z,11Z,14Z,17Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:3(5Z,8Z,11Z)/20:4(8Z,11Z,14Z,17Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(5Z,8Z,11Z)/20:4(8Z,11Z,14Z,17Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(5Z,8Z,11Z)/20:4(8Z,11Z,14Z,17Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(5Z,8Z,11Z)/20:4(8Z,11Z,14Z,17Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(5Z,8Z,11Z)/20:4(8Z,11Z,14Z,17Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(5Z,8Z,11Z)/20:4(8Z,11Z,14Z,17Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(5Z,8Z,11Z)/20:4(8Z,11Z,14Z,17Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:3(5Z,8Z,11Z)/20:4(8Z,11Z,14Z,17Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(5Z,8Z,11Z)/20:5(5Z,8Z,11Z,14Z,17Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(5Z,8Z,11Z)/20:5(5Z,8Z,11Z,14Z,17Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:3(5Z,8Z,11Z)/20:5(5Z,8Z,11Z,14Z,17Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(5Z,8Z,11Z)/20:5(5Z,8Z,11Z,14Z,17Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(5Z,8Z,11Z)/20:5(5Z,8Z,11Z,14Z,17Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(5Z,8Z,11Z)/20:5(5Z,8Z,11Z,14Z,17Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(5Z,8Z,11Z)/20:5(5Z,8Z,11Z,14Z,17Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(5Z,8Z,11Z)/20:5(5Z,8Z,11Z,14Z,17Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(5Z,8Z,11Z)/20:5(5Z,8Z,11Z,14Z,17Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:3(5Z,8Z,11Z)/20:5(5Z,8Z,11Z,14Z,17Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(5Z,8Z,11Z)/22:0/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:3(5Z,8Z,11Z)/22:0/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(5Z,8Z,11Z)/22:0/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(5Z,8Z,11Z)/22:0/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(5Z,8Z,11Z)/22:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(5Z,8Z,11Z)/22:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(5Z,8Z,11Z)/22:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(5Z,8Z,11Z)/22:0/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:3(5Z,8Z,11Z)/22:0/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(5Z,8Z,11Z)/22:1(13Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(5Z,8Z,11Z)/22:1(13Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(5Z,8Z,11Z)/22:1(13Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(5Z,8Z,11Z)/22:1(13Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(5Z,8Z,11Z)/22:1(13Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(5Z,8Z,11Z)/22:1(13Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(5Z,8Z,11Z)/22:1(13Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:3(5Z,8Z,11Z)/22:1(13Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(5Z,8Z,11Z)/22:2(13Z,16Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(5Z,8Z,11Z)/22:2(13Z,16Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(5Z,8Z,11Z)/22:2(13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(5Z,8Z,11Z)/22:2(13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(5Z,8Z,11Z)/22:2(13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(5Z,8Z,11Z)/22:2(13Z,16Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:3(5Z,8Z,11Z)/22:2(13Z,16Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(5Z,8Z,11Z)/22:4(7Z,10Z,13Z,16Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(5Z,8Z,11Z)/22:4(7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(5Z,8Z,11Z)/22:4(7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(5Z,8Z,11Z)/22:4(7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(5Z,8Z,11Z)/22:4(7Z,10Z,13Z,16Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:3(5Z,8Z,11Z)/22:4(7Z,10Z,13Z,16Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(5Z,8Z,11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(5Z,8Z,11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(5Z,8Z,11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(5Z,8Z,11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:3(5Z,8Z,11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(5Z,8Z,11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(5Z,8Z,11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(5Z,8Z,11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:3(5Z,8Z,11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(5Z,8Z,11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(5Z,8Z,11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:3(5Z,8Z,11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(5Z,8Z,11Z)/24:0/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:3(5Z,8Z,11Z)/24:0/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(5Z,8Z,11Z)/24:1(15Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(8Z,11Z,14Z)/20:3(8Z,11Z,14Z)/20:3(8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(8Z,11Z,14Z)/20:3(8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(8Z,11Z,14Z)/20:3(8Z,11Z,14Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(8Z,11Z,14Z)/20:3(8Z,11Z,14Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(8Z,11Z,14Z)/20:3(8Z,11Z,14Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:3(8Z,11Z,14Z)/20:3(8Z,11Z,14Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(8Z,11Z,14Z)/20:3(8Z,11Z,14Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(8Z,11Z,14Z)/20:3(8Z,11Z,14Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(8Z,11Z,14Z)/20:3(8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(8Z,11Z,14Z)/20:3(8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(8Z,11Z,14Z)/20:3(8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(8Z,11Z,14Z)/20:3(8Z,11Z,14Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:3(8Z,11Z,14Z)/20:3(8Z,11Z,14Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:3(8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:3(8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(8Z,11Z,14Z)/20:4(8Z,11Z,14Z,17Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(8Z,11Z,14Z)/20:4(8Z,11Z,14Z,17Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(8Z,11Z,14Z)/20:4(8Z,11Z,14Z,17Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:3(8Z,11Z,14Z)/20:4(8Z,11Z,14Z,17Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(8Z,11Z,14Z)/20:4(8Z,11Z,14Z,17Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(8Z,11Z,14Z)/20:4(8Z,11Z,14Z,17Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(8Z,11Z,14Z)/20:4(8Z,11Z,14Z,17Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(8Z,11Z,14Z)/20:4(8Z,11Z,14Z,17Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(8Z,11Z,14Z)/20:4(8Z,11Z,14Z,17Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(8Z,11Z,14Z)/20:4(8Z,11Z,14Z,17Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:3(8Z,11Z,14Z)/20:4(8Z,11Z,14Z,17Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(8Z,11Z,14Z)/20:5(5Z,8Z,11Z,14Z,17Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(8Z,11Z,14Z)/20:5(5Z,8Z,11Z,14Z,17Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:3(8Z,11Z,14Z)/20:5(5Z,8Z,11Z,14Z,17Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(8Z,11Z,14Z)/20:5(5Z,8Z,11Z,14Z,17Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(8Z,11Z,14Z)/20:5(5Z,8Z,11Z,14Z,17Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(8Z,11Z,14Z)/20:5(5Z,8Z,11Z,14Z,17Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(8Z,11Z,14Z)/20:5(5Z,8Z,11Z,14Z,17Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(8Z,11Z,14Z)/20:5(5Z,8Z,11Z,14Z,17Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(8Z,11Z,14Z)/20:5(5Z,8Z,11Z,14Z,17Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:3(8Z,11Z,14Z)/20:5(5Z,8Z,11Z,14Z,17Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(8Z,11Z,14Z)/22:0/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:3(8Z,11Z,14Z)/22:0/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(8Z,11Z,14Z)/22:0/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(8Z,11Z,14Z)/22:0/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(8Z,11Z,14Z)/22:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(8Z,11Z,14Z)/22:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(8Z,11Z,14Z)/22:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(8Z,11Z,14Z)/22:0/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:3(8Z,11Z,14Z)/22:0/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(8Z,11Z,14Z)/22:1(13Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(8Z,11Z,14Z)/22:1(13Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(8Z,11Z,14Z)/22:1(13Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(8Z,11Z,14Z)/22:1(13Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(8Z,11Z,14Z)/22:1(13Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(8Z,11Z,14Z)/22:1(13Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(8Z,11Z,14Z)/22:1(13Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:3(8Z,11Z,14Z)/22:1(13Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(8Z,11Z,14Z)/22:2(13Z,16Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(8Z,11Z,14Z)/22:2(13Z,16Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(8Z,11Z,14Z)/22:2(13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(8Z,11Z,14Z)/22:2(13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(8Z,11Z,14Z)/22:2(13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(8Z,11Z,14Z)/22:2(13Z,16Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:3(8Z,11Z,14Z)/22:2(13Z,16Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(8Z,11Z,14Z)/22:4(7Z,10Z,13Z,16Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(8Z,11Z,14Z)/22:4(7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(8Z,11Z,14Z)/22:4(7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(8Z,11Z,14Z)/22:4(7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(8Z,11Z,14Z)/22:4(7Z,10Z,13Z,16Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:3(8Z,11Z,14Z)/22:4(7Z,10Z,13Z,16Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:3(8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:3(8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:3(8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(8Z,11Z,14Z)/24:0/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:3(8Z,11Z,14Z)/24:0/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:3(8Z,11Z,14Z)/24:1(15Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:4(5Z,8Z,11Z,14Z)/20:4(8Z,11Z,14Z,17Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:4(5Z,8Z,11Z,14Z)/20:4(8Z,11Z,14Z,17Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:4(5Z,8Z,11Z,14Z)/20:4(8Z,11Z,14Z,17Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:4(5Z,8Z,11Z,14Z)/20:4(8Z,11Z,14Z,17Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:4(5Z,8Z,11Z,14Z)/20:4(8Z,11Z,14Z,17Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:4(5Z,8Z,11Z,14Z)/20:4(8Z,11Z,14Z,17Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:4(5Z,8Z,11Z,14Z)/20:4(8Z,11Z,14Z,17Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:4(5Z,8Z,11Z,14Z)/20:4(8Z,11Z,14Z,17Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:4(5Z,8Z,11Z,14Z)/20:4(8Z,11Z,14Z,17Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:4(5Z,8Z,11Z,14Z)/20:4(8Z,11Z,14Z,17Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:4(5Z,8Z,11Z,14Z)/20:4(8Z,11Z,14Z,17Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:4(5Z,8Z,11Z,14Z)/20:5(5Z,8Z,11Z,14Z,17Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:4(5Z,8Z,11Z,14Z)/20:5(5Z,8Z,11Z,14Z,17Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:4(5Z,8Z,11Z,14Z)/20:5(5Z,8Z,11Z,14Z,17Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:4(5Z,8Z,11Z,14Z)/20:5(5Z,8Z,11Z,14Z,17Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:4(5Z,8Z,11Z,14Z)/20:5(5Z,8Z,11Z,14Z,17Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:4(5Z,8Z,11Z,14Z)/20:5(5Z,8Z,11Z,14Z,17Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:4(5Z,8Z,11Z,14Z)/20:5(5Z,8Z,11Z,14Z,17Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:4(5Z,8Z,11Z,14Z)/20:5(5Z,8Z,11Z,14Z,17Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:4(5Z,8Z,11Z,14Z)/20:5(5Z,8Z,11Z,14Z,17Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:4(5Z,8Z,11Z,14Z)/20:5(5Z,8Z,11Z,14Z,17Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:4(5Z,8Z,11Z,14Z)/22:0/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:4(5Z,8Z,11Z,14Z)/22:0/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:4(5Z,8Z,11Z,14Z)/22:0/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:4(5Z,8Z,11Z,14Z)/22:0/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:4(5Z,8Z,11Z,14Z)/22:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:4(5Z,8Z,11Z,14Z)/22:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:4(5Z,8Z,11Z,14Z)/22:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:4(5Z,8Z,11Z,14Z)/22:0/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:4(5Z,8Z,11Z,14Z)/22:0/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:4(5Z,8Z,11Z,14Z)/22:1(13Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:4(5Z,8Z,11Z,14Z)/22:1(13Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:4(5Z,8Z,11Z,14Z)/22:1(13Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:4(5Z,8Z,11Z,14Z)/22:1(13Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:4(5Z,8Z,11Z,14Z)/22:1(13Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:4(5Z,8Z,11Z,14Z)/22:1(13Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:4(5Z,8Z,11Z,14Z)/22:1(13Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:4(5Z,8Z,11Z,14Z)/22:1(13Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:4(5Z,8Z,11Z,14Z)/22:2(13Z,16Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:4(5Z,8Z,11Z,14Z)/22:2(13Z,16Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:4(5Z,8Z,11Z,14Z)/22:2(13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:4(5Z,8Z,11Z,14Z)/22:2(13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:4(5Z,8Z,11Z,14Z)/22:2(13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:4(5Z,8Z,11Z,14Z)/22:2(13Z,16Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:4(5Z,8Z,11Z,14Z)/22:2(13Z,16Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:4(5Z,8Z,11Z,14Z)/22:4(7Z,10Z,13Z,16Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:4(5Z,8Z,11Z,14Z)/22:4(7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:4(5Z,8Z,11Z,14Z)/22:4(7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:4(5Z,8Z,11Z,14Z)/22:4(7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:4(5Z,8Z,11Z,14Z)/22:4(7Z,10Z,13Z,16Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:4(5Z,8Z,11Z,14Z)/22:4(7Z,10Z,13Z,16Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:4(5Z,8Z,11Z,14Z)/24:0/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:4(5Z,8Z,11Z,14Z)/24:0/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:4(5Z,8Z,11Z,14Z)/24:1(15Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:4(8Z,11Z,14Z,17Z)/20:4(8Z,11Z,14Z,17Z)/20:4(8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:4(8Z,11Z,14Z,17Z)/20:4(8Z,11Z,14Z,17Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:4(8Z,11Z,14Z,17Z)/20:4(8Z,11Z,14Z,17Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:4(8Z,11Z,14Z,17Z)/20:4(8Z,11Z,14Z,17Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:4(8Z,11Z,14Z,17Z)/20:4(8Z,11Z,14Z,17Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:4(8Z,11Z,14Z,17Z)/20:4(8Z,11Z,14Z,17Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:4(8Z,11Z,14Z,17Z)/20:4(8Z,11Z,14Z,17Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:4(8Z,11Z,14Z,17Z)/20:4(8Z,11Z,14Z,17Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:4(8Z,11Z,14Z,17Z)/20:4(8Z,11Z,14Z,17Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:4(8Z,11Z,14Z,17Z)/20:4(8Z,11Z,14Z,17Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:4(8Z,11Z,14Z,17Z)/20:4(8Z,11Z,14Z,17Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:4(8Z,11Z,14Z,17Z)/20:5(5Z,8Z,11Z,14Z,17Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:4(8Z,11Z,14Z,17Z)/20:5(5Z,8Z,11Z,14Z,17Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:4(8Z,11Z,14Z,17Z)/20:5(5Z,8Z,11Z,14Z,17Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:4(8Z,11Z,14Z,17Z)/20:5(5Z,8Z,11Z,14Z,17Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:4(8Z,11Z,14Z,17Z)/20:5(5Z,8Z,11Z,14Z,17Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:4(8Z,11Z,14Z,17Z)/20:5(5Z,8Z,11Z,14Z,17Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:4(8Z,11Z,14Z,17Z)/20:5(5Z,8Z,11Z,14Z,17Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:4(8Z,11Z,14Z,17Z)/20:5(5Z,8Z,11Z,14Z,17Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:4(8Z,11Z,14Z,17Z)/20:5(5Z,8Z,11Z,14Z,17Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:4(8Z,11Z,14Z,17Z)/20:5(5Z,8Z,11Z,14Z,17Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:4(8Z,11Z,14Z,17Z)/22:0/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:4(8Z,11Z,14Z,17Z)/22:0/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:4(8Z,11Z,14Z,17Z)/22:0/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:4(8Z,11Z,14Z,17Z)/22:0/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:4(8Z,11Z,14Z,17Z)/22:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:4(8Z,11Z,14Z,17Z)/22:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:4(8Z,11Z,14Z,17Z)/22:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:4(8Z,11Z,14Z,17Z)/22:0/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:4(8Z,11Z,14Z,17Z)/22:0/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:4(8Z,11Z,14Z,17Z)/22:1(13Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:4(8Z,11Z,14Z,17Z)/22:1(13Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:4(8Z,11Z,14Z,17Z)/22:1(13Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:4(8Z,11Z,14Z,17Z)/22:1(13Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:4(8Z,11Z,14Z,17Z)/22:1(13Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:4(8Z,11Z,14Z,17Z)/22:1(13Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:4(8Z,11Z,14Z,17Z)/22:1(13Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:4(8Z,11Z,14Z,17Z)/22:1(13Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:4(8Z,11Z,14Z,17Z)/22:2(13Z,16Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:4(8Z,11Z,14Z,17Z)/22:2(13Z,16Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:4(8Z,11Z,14Z,17Z)/22:2(13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:4(8Z,11Z,14Z,17Z)/22:2(13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:4(8Z,11Z,14Z,17Z)/22:2(13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:4(8Z,11Z,14Z,17Z)/22:2(13Z,16Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:4(8Z,11Z,14Z,17Z)/22:2(13Z,16Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:4(8Z,11Z,14Z,17Z)/22:4(7Z,10Z,13Z,16Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:4(8Z,11Z,14Z,17Z)/22:4(7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:4(8Z,11Z,14Z,17Z)/22:4(7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:4(8Z,11Z,14Z,17Z)/22:4(7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:4(8Z,11Z,14Z,17Z)/22:4(7Z,10Z,13Z,16Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:4(8Z,11Z,14Z,17Z)/22:4(7Z,10Z,13Z,16Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:4(8Z,11Z,14Z,17Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:4(8Z,11Z,14Z,17Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:4(8Z,11Z,14Z,17Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:4(8Z,11Z,14Z,17Z)/22:5(4Z,7Z,10Z,13Z,16Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:4(8Z,11Z,14Z,17Z)/22:5(4Z,7Z,10Z,13Z,16Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:4(8Z,11Z,14Z,17Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:4(8Z,11Z,14Z,17Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:4(8Z,11Z,14Z,17Z)/22:5(7Z,10Z,13Z,16Z,19Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:4(8Z,11Z,14Z,17Z)/22:5(7Z,10Z,13Z,16Z,19Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:4(8Z,11Z,14Z,17Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:4(8Z,11Z,14Z,17Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:4(8Z,11Z,14Z,17Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:4(8Z,11Z,14Z,17Z)/24:0/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:4(8Z,11Z,14Z,17Z)/24:0/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:4(8Z,11Z,14Z,17Z)/24:1(15Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:5(5Z,8Z,11Z,14Z,17Z)/20:5(5Z,8Z,11Z,14Z,17Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:5(5Z,8Z,11Z,14Z,17Z)/20:5(5Z,8Z,11Z,14Z,17Z)/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:5(5Z,8Z,11Z,14Z,17Z)/20:5(5Z,8Z,11Z,14Z,17Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:5(5Z,8Z,11Z,14Z,17Z)/20:5(5Z,8Z,11Z,14Z,17Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:5(5Z,8Z,11Z,14Z,17Z)/20:5(5Z,8Z,11Z,14Z,17Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:5(5Z,8Z,11Z,14Z,17Z)/20:5(5Z,8Z,11Z,14Z,17Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:5(5Z,8Z,11Z,14Z,17Z)/20:5(5Z,8Z,11Z,14Z,17Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:5(5Z,8Z,11Z,14Z,17Z)/20:5(5Z,8Z,11Z,14Z,17Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:5(5Z,8Z,11Z,14Z,17Z)/20:5(5Z,8Z,11Z,14Z,17Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:5(5Z,8Z,11Z,14Z,17Z)/20:5(5Z,8Z,11Z,14Z,17Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:5(5Z,8Z,11Z,14Z,17Z)/22:0/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:5(5Z,8Z,11Z,14Z,17Z)/22:0/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:5(5Z,8Z,11Z,14Z,17Z)/22:0/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:5(5Z,8Z,11Z,14Z,17Z)/22:0/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:5(5Z,8Z,11Z,14Z,17Z)/22:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:5(5Z,8Z,11Z,14Z,17Z)/22:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:5(5Z,8Z,11Z,14Z,17Z)/22:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:5(5Z,8Z,11Z,14Z,17Z)/22:0/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:5(5Z,8Z,11Z,14Z,17Z)/22:0/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:5(5Z,8Z,11Z,14Z,17Z)/22:1(13Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:5(5Z,8Z,11Z,14Z,17Z)/22:1(13Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:5(5Z,8Z,11Z,14Z,17Z)/22:1(13Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:5(5Z,8Z,11Z,14Z,17Z)/22:1(13Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:5(5Z,8Z,11Z,14Z,17Z)/22:1(13Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:5(5Z,8Z,11Z,14Z,17Z)/22:1(13Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:5(5Z,8Z,11Z,14Z,17Z)/22:1(13Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:5(5Z,8Z,11Z,14Z,17Z)/22:1(13Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:5(5Z,8Z,11Z,14Z,17Z)/22:2(13Z,16Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:5(5Z,8Z,11Z,14Z,17Z)/22:2(13Z,16Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:5(5Z,8Z,11Z,14Z,17Z)/22:2(13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:5(5Z,8Z,11Z,14Z,17Z)/22:2(13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:5(5Z,8Z,11Z,14Z,17Z)/22:2(13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:5(5Z,8Z,11Z,14Z,17Z)/22:2(13Z,16Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:5(5Z,8Z,11Z,14Z,17Z)/22:2(13Z,16Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:5(5Z,8Z,11Z,14Z,17Z)/22:4(7Z,10Z,13Z,16Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:5(5Z,8Z,11Z,14Z,17Z)/22:4(7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:5(5Z,8Z,11Z,14Z,17Z)/22:4(7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:5(5Z,8Z,11Z,14Z,17Z)/22:4(7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:5(5Z,8Z,11Z,14Z,17Z)/22:4(7Z,10Z,13Z,16Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:5(5Z,8Z,11Z,14Z,17Z)/22:4(7Z,10Z,13Z,16Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:5(5Z,8Z,11Z,14Z,17Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:5(5Z,8Z,11Z,14Z,17Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:5(5Z,8Z,11Z,14Z,17Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:5(5Z,8Z,11Z,14Z,17Z)/22:5(4Z,7Z,10Z,13Z,16Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:5(5Z,8Z,11Z,14Z,17Z)/22:5(4Z,7Z,10Z,13Z,16Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:5(5Z,8Z,11Z,14Z,17Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:5(5Z,8Z,11Z,14Z,17Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:5(5Z,8Z,11Z,14Z,17Z)/22:5(7Z,10Z,13Z,16Z,19Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:5(5Z,8Z,11Z,14Z,17Z)/22:5(7Z,10Z,13Z,16Z,19Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:5(5Z,8Z,11Z,14Z,17Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:5(5Z,8Z,11Z,14Z,17Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:5(5Z,8Z,11Z,14Z,17Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:5(5Z,8Z,11Z,14Z,17Z)/24:0/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(20:5(5Z,8Z,11Z,14Z,17Z)/24:0/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(20:5(5Z,8Z,11Z,14Z,17Z)/24:1(15Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(21:0/10:0/10:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/10:0/12:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/10:0/13:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/10:0/17:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/10:0/18:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/10:0/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/12:0/12:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/12:0/13:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/12:0/14:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/12:0/15:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/12:0/16:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/12:0/18:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/12:0/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/12:0/a-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/12:0/a-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/12:0/a-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/12:0/a-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/12:0/a-25:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/12:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/12:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/12:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/12:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/12:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/12:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/12:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/12:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/12:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/12:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/12:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/12:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/13:0/13:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/13:0/16:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/13:0/17:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/13:0/18:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/13:0/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/13:0/a-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/13:0/a-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/13:0/a-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/13:0/a-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/13:0/a-25:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/13:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/13:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/13:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/13:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/13:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/13:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/13:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/13:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/13:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/13:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/13:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/13:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/14:0/10:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/14:0/13:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/14:0/14:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/14:0/16:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/14:0/17:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/14:0/18:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/14:0/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/14:0/8:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/14:0/a-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/14:0/a-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/14:0/a-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/14:0/a-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/14:0/a-25:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/14:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/14:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/14:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/14:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/14:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/14:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/14:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/14:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/14:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/14:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/14:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/14:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/15:0/10:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/15:0/13:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/15:0/14:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/15:0/15:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/15:0/17:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/15:0/18:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/15:0/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/15:0/8:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/15:0/a-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/15:0/a-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/15:0/a-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/15:0/a-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/15:0/a-25:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/15:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/15:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/15:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/15:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/15:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/15:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/15:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/15:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/15:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/15:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/15:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/15:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/16:0/10:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/16:0/15:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/16:0/16:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/16:0/17:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/16:0/18:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/16:0/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/16:0/a-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/16:0/a-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/16:0/a-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/16:0/a-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/16:0/a-25:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/16:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/16:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/16:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/16:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/16:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/16:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/16:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/16:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/16:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/16:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/16:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/16:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/17:0/12:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/17:0/17:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/17:0/8:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/17:0/a-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/17:0/a-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/17:0/a-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/17:0/a-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/17:0/a-25:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/17:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/17:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/17:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/17:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/17:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/17:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/17:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/17:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/17:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/17:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/17:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/17:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/18:0/17:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/18:0/18:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/18:0/a-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/18:0/a-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/18:0/a-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/18:0/a-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/18:0/a-25:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/18:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/18:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/18:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/18:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/18:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/18:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/18:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/18:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/18:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/18:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/18:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/18:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/21:0/10:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/21:0/12:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/21:0/13:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/21:0/14:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/21:0/15:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/21:0/16:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/21:0/17:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/21:0/18:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/21:0/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/21:0/8:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/21:0/a-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/21:0/a-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/21:0/a-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/21:0/a-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/21:0/a-25:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/21:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/21:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/21:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/21:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/21:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/21:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/21:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/21:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/21:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/21:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/21:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/21:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/22:0/17:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/22:0/18:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/22:0/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/22:0/a-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/22:0/a-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/22:0/a-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/22:0/a-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/22:0/a-25:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/22:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/22:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/22:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/22:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/22:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/22:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/22:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/22:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/22:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/22:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/22:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/22:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/8:0/10:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/8:0/12:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/8:0/13:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/8:0/16:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/8:0/18:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/8:0/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/8:0/8:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/8:0/a-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/8:0/a-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/8:0/a-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/8:0/a-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/8:0/a-25:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/8:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/8:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/8:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/8:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/8:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/8:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/8:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/8:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/8:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/8:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/8:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/8:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/a-13:0/a-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/a-13:0/a-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/a-13:0/a-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/a-13:0/a-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/a-13:0/a-25:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/a-13:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/a-13:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/a-13:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/a-13:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/a-13:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/a-13:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/a-13:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/a-13:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/a-13:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/a-13:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/a-13:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/a-13:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/a-15:0/a-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/a-15:0/a-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/a-15:0/a-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/a-15:0/a-25:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/a-15:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/a-15:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/a-15:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/a-15:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/a-15:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/a-15:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/a-15:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/a-15:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/a-15:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/a-15:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/a-15:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/a-15:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/a-17:0/a-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/a-17:0/a-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/a-17:0/a-25:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/a-17:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/a-17:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/a-17:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/a-17:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/a-17:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/a-17:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/a-17:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/a-17:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/a-17:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/a-17:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/a-17:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/a-17:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/a-21:0/a-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/a-21:0/a-25:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/a-21:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/a-21:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/a-21:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/a-21:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/a-21:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/a-21:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/a-21:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/a-21:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/a-21:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/a-21:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/a-21:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/a-21:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/a-25:0/a-25:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/a-25:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/a-25:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/a-25:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/a-25:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/a-25:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/a-25:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/a-25:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/a-25:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/a-25:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/a-25:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/a-25:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/a-25:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/i-12:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/i-12:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/i-12:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/i-12:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/i-12:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/i-12:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/i-12:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/i-12:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/i-12:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/i-12:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/i-12:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/i-12:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/i-13:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/i-13:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/i-13:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/i-13:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/i-13:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/i-13:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/i-13:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/i-13:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/i-13:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/i-13:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/i-13:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/i-14:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/i-14:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/i-14:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/i-14:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/i-14:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/i-14:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/i-14:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/i-14:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/i-14:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/i-14:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/i-15:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/i-15:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/i-15:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/i-15:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/i-15:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/i-15:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/i-15:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/i-15:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/i-15:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/i-16:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/i-16:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/i-16:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/i-16:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/i-16:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/i-16:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/i-16:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/i-16:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/i-17:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/i-17:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/i-17:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/i-17:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/i-17:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/i-17:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/i-17:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/i-18:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/i-18:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/i-18:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/i-18:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/i-18:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/i-18:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/i-19:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/i-19:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/i-19:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/i-19:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/i-19:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/i-20:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/i-20:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/i-20:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/i-20:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/i-21:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/i-21:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/i-21:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/i-22:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/i-22:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(21:0/i-24:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/10:0/10:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/10:0/12:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/10:0/13:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/12:0/12:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/12:0/13:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/12:0/14:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/12:0/15:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/12:0/18:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/12:0/8:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/12:0/a-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/12:0/a-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/12:0/a-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/12:0/a-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/12:0/a-25:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/12:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/12:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/12:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/12:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/12:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/12:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/12:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/12:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/12:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/12:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/12:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/12:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/13:0/13:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/13:0/15:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/13:0/16:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/13:0/17:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/13:0/18:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/13:0/8:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/13:0/a-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/13:0/a-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/13:0/a-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/13:0/a-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/13:0/a-25:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/13:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/13:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/13:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/13:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/13:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/13:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/13:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/13:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/13:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/13:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/13:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/13:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/14:0/10:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/14:0/13:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/14:0/a-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/14:0/a-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/14:0/a-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/14:0/a-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/14:0/a-25:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/14:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/14:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/14:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/14:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/14:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/14:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/14:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/14:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/14:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/14:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/14:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/14:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/15:0/10:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/15:0/8:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/15:0/a-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/15:0/a-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/15:0/a-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/15:0/a-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/15:0/a-25:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/15:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/15:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/15:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/15:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/15:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/15:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/15:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/15:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/15:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/15:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/15:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/15:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/16:0/10:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/16:0/12:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/16:0/a-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/16:0/a-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/16:0/a-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/16:0/a-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/16:0/a-25:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/16:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/16:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/16:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/16:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/16:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/16:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/16:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/16:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/16:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/16:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/16:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/16:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/17:0/10:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/17:0/12:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/17:0/14:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/17:0/15:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/17:0/16:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/17:0/17:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/17:0/8:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/17:0/a-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/17:0/a-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/17:0/a-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/17:0/a-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/17:0/a-25:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/17:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/17:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/17:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/17:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/17:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/17:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/17:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/17:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/17:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/17:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/17:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/17:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/18:0/10:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/18:0/17:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/18:0/8:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/18:0/a-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/18:0/a-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/18:0/a-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/18:0/a-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/18:0/a-25:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/18:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/18:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/18:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/18:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/18:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/18:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/18:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/18:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/18:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/18:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/18:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/18:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/22:0/10:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/22:0/12:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/22:0/13:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/22:0/17:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/22:0/22:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/22:0/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(22:0/22:0/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(22:0/22:0/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(22:0/22:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(22:0/22:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(22:0/22:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(22:0/22:0/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/22:0/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(22:0/22:0/8:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/22:0/a-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/22:0/a-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/22:0/a-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/22:0/a-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/22:0/a-25:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/22:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/22:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/22:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/22:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/22:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/22:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/22:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/22:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/22:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/22:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/22:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/22:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/22:1(13Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(22:0/22:1(13Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(22:0/22:1(13Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(22:0/22:1(13Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(22:0/22:1(13Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(22:0/22:1(13Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(22:0/22:1(13Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/22:1(13Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(22:0/22:2(13Z,16Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(22:0/22:2(13Z,16Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(22:0/22:2(13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(22:0/22:2(13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(22:0/22:2(13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(22:0/22:2(13Z,16Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/22:2(13Z,16Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(22:0/22:4(7Z,10Z,13Z,16Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(22:0/22:4(7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(22:0/22:4(7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(22:0/22:4(7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(22:0/22:4(7Z,10Z,13Z,16Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/22:4(7Z,10Z,13Z,16Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(22:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(22:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(22:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(22:0/22:5(4Z,7Z,10Z,13Z,16Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/22:5(4Z,7Z,10Z,13Z,16Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(22:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(22:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(22:0/22:5(7Z,10Z,13Z,16Z,19Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/22:5(7Z,10Z,13Z,16Z,19Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(22:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(22:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(22:0/24:0/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/24:0/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(22:0/24:1(15Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(22:0/8:0/10:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/8:0/14:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/8:0/16:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/8:0/8:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/8:0/a-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/8:0/a-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/8:0/a-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/8:0/a-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/8:0/a-25:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/8:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/8:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/8:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/8:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/8:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/8:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/8:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/8:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/8:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/8:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/8:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/8:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/a-13:0/a-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/a-13:0/a-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/a-13:0/a-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/a-13:0/a-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/a-13:0/a-25:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/a-13:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/a-13:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/a-13:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/a-13:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/a-13:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/a-13:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/a-13:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/a-13:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/a-13:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/a-13:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/a-13:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/a-13:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/a-15:0/a-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/a-15:0/a-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/a-15:0/a-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/a-15:0/a-25:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/a-15:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/a-15:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/a-15:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/a-15:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/a-15:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/a-15:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/a-15:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/a-15:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/a-15:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/a-15:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/a-15:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/a-15:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/a-17:0/a-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/a-17:0/a-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/a-17:0/a-25:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/a-17:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/a-17:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/a-17:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/a-17:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/a-17:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/a-17:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/a-17:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/a-17:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/a-17:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/a-17:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/a-17:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/a-17:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/a-21:0/a-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/a-21:0/a-25:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/a-21:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/a-21:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/a-21:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/a-21:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/a-21:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/a-21:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/a-21:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/a-21:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/a-21:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/a-21:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/a-21:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/a-21:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/a-25:0/a-25:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/a-25:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/a-25:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/a-25:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/a-25:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/a-25:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/a-25:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/a-25:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/a-25:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/a-25:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/a-25:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/a-25:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/a-25:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/i-12:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/i-12:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/i-12:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/i-12:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/i-12:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/i-12:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/i-12:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/i-12:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/i-12:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/i-12:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/i-12:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/i-12:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/i-13:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/i-13:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/i-13:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/i-13:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/i-13:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/i-13:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/i-13:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/i-13:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/i-13:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/i-13:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/i-13:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/i-14:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/i-14:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/i-14:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/i-14:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/i-14:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/i-14:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/i-14:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/i-14:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/i-14:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/i-14:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/i-15:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/i-15:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/i-15:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/i-15:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/i-15:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/i-15:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/i-15:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/i-15:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/i-15:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/i-16:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/i-16:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/i-16:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/i-16:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/i-16:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/i-16:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/i-16:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/i-16:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/i-17:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/i-17:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/i-17:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/i-17:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/i-17:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/i-17:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/i-17:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/i-18:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/i-18:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/i-18:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/i-18:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/i-18:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/i-18:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/i-19:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/i-19:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/i-19:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/i-19:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/i-19:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/i-20:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/i-20:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/i-20:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/i-20:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/i-21:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/i-21:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/i-21:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/i-22:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/i-22:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:0/i-24:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:1(13Z)/19:2(10Z,13Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(22:1(13Z)/22:1(13Z)/22:1(13Z))
  • De Novo Triacylglycerol Biosynthesis TG(22:1(13Z)/22:1(13Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(22:1(13Z)/22:1(13Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(22:1(13Z)/22:1(13Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(22:1(13Z)/22:1(13Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(22:1(13Z)/22:1(13Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(22:1(13Z)/22:1(13Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:1(13Z)/22:1(13Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(22:1(13Z)/22:2(13Z,16Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(22:1(13Z)/22:2(13Z,16Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(22:1(13Z)/22:2(13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(22:1(13Z)/22:2(13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(22:1(13Z)/22:2(13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(22:1(13Z)/22:2(13Z,16Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:1(13Z)/22:2(13Z,16Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(22:1(13Z)/22:4(7Z,10Z,13Z,16Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(22:1(13Z)/22:4(7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(22:1(13Z)/22:4(7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(22:1(13Z)/22:4(7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(22:1(13Z)/22:4(7Z,10Z,13Z,16Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:1(13Z)/22:4(7Z,10Z,13Z,16Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(22:1(13Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(22:1(13Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(22:1(13Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(22:1(13Z)/22:5(4Z,7Z,10Z,13Z,16Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:1(13Z)/22:5(4Z,7Z,10Z,13Z,16Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(22:1(13Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(22:1(13Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(22:1(13Z)/22:5(7Z,10Z,13Z,16Z,19Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:1(13Z)/22:5(7Z,10Z,13Z,16Z,19Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(22:1(13Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(22:1(13Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:1(13Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(22:1(13Z)/24:0/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:1(13Z)/24:0/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(22:1(13Z)/24:1(15Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(22:2(13Z,16Z)/22:2(13Z,16Z)/22:2(13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(22:2(13Z,16Z)/22:2(13Z,16Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(22:2(13Z,16Z)/22:2(13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(22:2(13Z,16Z)/22:2(13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(22:2(13Z,16Z)/22:2(13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(22:2(13Z,16Z)/22:2(13Z,16Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:2(13Z,16Z)/22:2(13Z,16Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(22:2(13Z,16Z)/22:4(7Z,10Z,13Z,16Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(22:2(13Z,16Z)/22:4(7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(22:2(13Z,16Z)/22:4(7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(22:2(13Z,16Z)/22:4(7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(22:2(13Z,16Z)/22:4(7Z,10Z,13Z,16Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:2(13Z,16Z)/22:4(7Z,10Z,13Z,16Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(22:2(13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(22:2(13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(22:2(13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(22:2(13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:2(13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(22:2(13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(22:2(13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(22:2(13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:2(13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(22:2(13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(22:2(13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:2(13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(22:2(13Z,16Z)/24:0/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:2(13Z,16Z)/24:0/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(22:2(13Z,16Z)/24:1(15Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(22:4(7Z,10Z,13Z,16Z)/22:4(7Z,10Z,13Z,16Z)/22:4(7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(22:4(7Z,10Z,13Z,16Z)/22:4(7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(22:4(7Z,10Z,13Z,16Z)/22:4(7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(22:4(7Z,10Z,13Z,16Z)/22:4(7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(22:4(7Z,10Z,13Z,16Z)/22:4(7Z,10Z,13Z,16Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:4(7Z,10Z,13Z,16Z)/22:4(7Z,10Z,13Z,16Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(22:4(7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(22:4(7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(22:4(7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(22:4(7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:4(7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(22:4(7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(22:4(7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(22:4(7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:4(7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(22:4(7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(22:4(7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:4(7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(22:4(7Z,10Z,13Z,16Z)/24:0/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:4(7Z,10Z,13Z,16Z)/24:0/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(22:4(7Z,10Z,13Z,16Z)/24:1(15Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • De Novo Triacylglycerol Biosynthesis TG(22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(22:5(4Z,7Z,10Z,13Z,16Z)/24:0/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:5(4Z,7Z,10Z,13Z,16Z)/24:0/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(22:5(4Z,7Z,10Z,13Z,16Z)/24:1(15Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(22:5(7Z,10Z,13Z,16Z,19Z)/24:0/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:5(7Z,10Z,13Z,16Z,19Z)/24:0/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(22:5(7Z,10Z,13Z,16Z,19Z)/24:1(15Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • De Novo Triacylglycerol Biosynthesis TG(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/24:0/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/24:0/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/24:1(15Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(24:0/24:0/24:0)
  • De Novo Triacylglycerol Biosynthesis TG(24:0/24:0/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(24:0/24:1(15Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(24:1(15Z)/24:1(15Z)/24:1(15Z))
  • De Novo Triacylglycerol Biosynthesis TG(8:0/12:0/10:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/12:0/12:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/12:0/16:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/12:0/18:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/12:0/a-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/12:0/a-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/12:0/a-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/12:0/a-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/12:0/a-25:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/12:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/12:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/12:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/12:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/12:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/12:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/12:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/12:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/12:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/12:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/12:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/12:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/13:0/12:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/13:0/13:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/13:0/14:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/13:0/15:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/13:0/17:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/13:0/19:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/13:0/a-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/13:0/a-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/13:0/a-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/13:0/a-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/13:0/a-25:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/13:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/13:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/13:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/13:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/13:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/13:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/13:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/13:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/13:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/13:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/13:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/13:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/14:0/10:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/14:0/12:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/14:0/14:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/14:0/15:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/14:0/17:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/14:0/18:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/14:0/a-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/14:0/a-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/14:0/a-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/14:0/a-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/14:0/a-25:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/14:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/14:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/14:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/14:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/14:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/14:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/14:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/14:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/14:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/14:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/14:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/14:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/15:0/12:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/15:0/15:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/15:0/17:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/15:0/a-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/15:0/a-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/15:0/a-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/15:0/a-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/15:0/a-25:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/15:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/15:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/15:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/15:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/15:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/15:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/15:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/15:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/15:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/15:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/15:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/15:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/16:0/13:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/16:0/14:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/16:0/15:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/16:0/16:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/16:0/18:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/16:0/19:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/16:0/a-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/16:0/a-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/16:0/a-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/16:0/a-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/16:0/a-25:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/16:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/16:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/16:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/16:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/16:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/16:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/16:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/16:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/16:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/16:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/16:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/16:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/17:0/12:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/17:0/16:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/17:0/17:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/17:0/a-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/17:0/a-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/17:0/a-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/17:0/a-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/17:0/a-25:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/17:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/17:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/17:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/17:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/17:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/17:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/17:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/17:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/17:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/17:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/17:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/17:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/18:0/13:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/18:0/15:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/18:0/17:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/18:0/18:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/18:0/a-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/18:0/a-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/18:0/a-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/18:0/a-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/18:0/a-25:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/18:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/18:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/18:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/18:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/18:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/18:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/18:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/18:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/18:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/18:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/18:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/18:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/19:0/10:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/19:0/12:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/19:0/14:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/19:0/15:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/19:0/17:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/19:0/18:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/19:0/19:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/19:0/a-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/19:0/a-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/19:0/a-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/19:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/19:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/19:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/19:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/19:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/19:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/19:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/19:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/19:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/8:0/12:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/8:0/13:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/8:0/14:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/8:0/15:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/8:0/16:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/8:0/17:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/8:0/18:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/8:0/19:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/8:0/8:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/8:0/a-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/8:0/a-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/8:0/a-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/8:0/a-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/8:0/a-25:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/8:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/8:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/8:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/8:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/8:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/8:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/8:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/8:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/8:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/8:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/8:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/8:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/a-13:0/a-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/a-13:0/a-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/a-13:0/a-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/a-13:0/a-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/a-13:0/a-25:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/a-13:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/a-13:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/a-13:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/a-13:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/a-13:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/a-13:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/a-13:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/a-13:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/a-13:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/a-13:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/a-13:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/a-13:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/a-15:0/a-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/a-15:0/a-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/a-15:0/a-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/a-15:0/a-25:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/a-15:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/a-15:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/a-15:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/a-15:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/a-15:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/a-15:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/a-15:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/a-15:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/a-15:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/a-15:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/a-15:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/a-15:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/a-17:0/a-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/a-17:0/a-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/a-17:0/a-25:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/a-17:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/a-17:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/a-17:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/a-17:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/a-17:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/a-17:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/a-17:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/a-17:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/a-17:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/a-17:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/a-17:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/a-17:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/a-21:0/a-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/a-21:0/a-25:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/a-21:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/a-21:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/a-21:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/a-21:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/a-21:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/a-21:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/a-21:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/a-21:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/a-21:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/a-21:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/a-21:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/a-21:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/a-25:0/a-25:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/a-25:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/a-25:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/a-25:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/a-25:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/a-25:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/a-25:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/a-25:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/a-25:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/a-25:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/a-25:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/a-25:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/a-25:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/i-12:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/i-12:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/i-12:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/i-12:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/i-12:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/i-12:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/i-12:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/i-12:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/i-12:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/i-12:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/i-12:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/i-12:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/i-13:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/i-13:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/i-13:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/i-13:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/i-13:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/i-13:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/i-13:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/i-13:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/i-13:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/i-13:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/i-13:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/i-14:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/i-14:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/i-14:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/i-14:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/i-14:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/i-14:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/i-14:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/i-14:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/i-14:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/i-14:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/i-15:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/i-15:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/i-15:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/i-15:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/i-15:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/i-15:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/i-15:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/i-15:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/i-15:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/i-16:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/i-16:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/i-16:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/i-16:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/i-16:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/i-16:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/i-16:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/i-16:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/i-17:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/i-17:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/i-17:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/i-17:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/i-17:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/i-17:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/i-17:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/i-18:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/i-18:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/i-18:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/i-18:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/i-18:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/i-18:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/i-19:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/i-19:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/i-19:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/i-19:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/i-19:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/i-20:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/i-20:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/i-20:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/i-20:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/i-21:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/i-21:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/i-21:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/i-22:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/i-22:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(8:0/i-24:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/12:0/12:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/12:0/13:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/12:0/14:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/12:0/15:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/12:0/16:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/12:0/17:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/12:0/18:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/12:0/a-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/12:0/a-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/12:0/a-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/12:0/a-25:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/12:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/12:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/12:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/12:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/12:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/12:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/12:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/12:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/12:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/12:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/12:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/12:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/13:0/13:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/13:0/14:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/13:0/15:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/13:0/16:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/13:0/17:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/13:0/18:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/13:0/a-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/13:0/a-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/13:0/a-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/13:0/a-25:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/13:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/13:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/13:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/13:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/13:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/13:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/13:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/13:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/13:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/13:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/13:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/13:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/14:0/14:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/14:0/15:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/14:0/16:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/14:0/17:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/14:0/18:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/14:0/a-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/14:0/a-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/14:0/a-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/14:0/a-25:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/14:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/14:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/14:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/14:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/14:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/14:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/14:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/14:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/14:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/14:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/14:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/14:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/15:0/15:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/15:0/16:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/15:0/17:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/15:0/18:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/15:0/a-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/15:0/a-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/15:0/a-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/15:0/a-25:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/15:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/15:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/15:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/15:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/15:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/15:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/15:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/15:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/15:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/15:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/15:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/15:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/16:0/16:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/16:0/17:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/16:0/18:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/16:0/a-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/16:0/a-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/16:0/a-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/16:0/a-25:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/16:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/16:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/16:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/16:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/16:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/16:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/16:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/16:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/16:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/16:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/16:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/16:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/17:0/17:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/17:0/18:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/17:0/a-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/17:0/a-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/17:0/a-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/17:0/a-25:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/17:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/17:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/17:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/17:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/17:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/17:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/17:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/17:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/17:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/17:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/17:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/17:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/18:0/18:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/18:0/a-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/18:0/a-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/18:0/a-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/18:0/a-25:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/18:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/18:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/18:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/18:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/18:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/18:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/18:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/18:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/18:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/18:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/18:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/18:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/a-13:0/a-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/a-13:0/a-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/a-13:0/a-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/a-13:0/a-25:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/a-13:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/a-13:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/a-13:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/a-13:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/a-13:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/a-13:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/a-13:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/a-13:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/a-13:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/a-13:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/a-13:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/a-15:0/a-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/a-15:0/a-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/a-15:0/a-25:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/a-15:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/a-15:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/a-15:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/a-15:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/a-15:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/a-15:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/a-15:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/a-15:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/a-15:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/a-15:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/a-15:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/a-15:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/a-17:0/a-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/a-17:0/a-25:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/a-17:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/a-17:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/a-17:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/a-17:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/a-17:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/a-17:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/a-17:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/a-17:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/a-17:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/a-17:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/a-17:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/a-17:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/a-21:0/12:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/a-21:0/13:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/a-21:0/14:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/a-21:0/15:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/a-21:0/16:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/a-21:0/17:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/a-21:0/18:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/a-21:0/a-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/a-21:0/a-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/a-21:0/a-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/a-21:0/a-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/a-21:0/a-25:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/a-21:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/a-21:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/a-21:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/a-21:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/a-21:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/a-21:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/a-21:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/a-21:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/a-21:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/a-21:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/a-21:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/a-21:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/a-25:0/a-25:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/a-25:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/a-25:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/a-25:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/a-25:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/a-25:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/a-25:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/a-25:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/a-25:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/a-25:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/a-25:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/a-25:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/a-25:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/i-12:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/i-12:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/i-12:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/i-12:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/i-12:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/i-12:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/i-12:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/i-12:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/i-12:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/i-12:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/i-12:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/i-12:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/i-13:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/i-13:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/i-13:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/i-13:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/i-13:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/i-13:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/i-13:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/i-13:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/i-13:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/i-13:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/i-13:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/i-14:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/i-14:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/i-14:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/i-14:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/i-14:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/i-14:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/i-14:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/i-14:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/i-14:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/i-14:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/i-15:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/i-15:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/i-15:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/i-15:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/i-15:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/i-15:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/i-15:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/i-15:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/i-15:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/i-16:0/a-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/i-16:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/i-16:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/i-16:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/i-16:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/i-16:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/i-16:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/i-16:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/i-16:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/i-17:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/i-17:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/i-17:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/i-17:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/i-17:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/i-17:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/i-17:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/i-18:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/i-18:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/i-18:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/i-18:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/i-18:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/i-18:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/i-19:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/i-19:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/i-19:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/i-19:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/i-19:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/i-20:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/i-20:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/i-20:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/i-20:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/i-21:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/i-21:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/i-21:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/i-22:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/i-22:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-21:0/i-24:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/12:0/12:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/12:0/13:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/12:0/14:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/12:0/15:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/12:0/16:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/12:0/17:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/12:0/18:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/12:0/a-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/12:0/a-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/12:0/a-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/12:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/12:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/12:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/12:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/12:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/12:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/12:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/12:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/12:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/12:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/12:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/12:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/13:0/13:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/13:0/14:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/13:0/15:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/13:0/16:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/13:0/17:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/13:0/18:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/13:0/a-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/13:0/a-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/13:0/a-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/13:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/13:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/13:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/13:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/13:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/13:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/13:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/13:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/13:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/13:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/13:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/13:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/14:0/14:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/14:0/15:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/14:0/16:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/14:0/17:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/14:0/18:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/14:0/a-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/14:0/a-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/14:0/a-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/14:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/14:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/14:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/14:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/14:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/14:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/14:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/14:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/14:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/14:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/14:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/14:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/15:0/15:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/15:0/16:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/15:0/17:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/15:0/18:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/15:0/a-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/15:0/a-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/15:0/a-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/15:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/15:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/15:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/15:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/15:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/15:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/15:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/15:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/15:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/15:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/15:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/15:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/16:0/16:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/16:0/17:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/16:0/18:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/16:0/a-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/16:0/a-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/16:0/a-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/16:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/16:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/16:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/16:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/16:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/16:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/16:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/16:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/16:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/16:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/16:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/16:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/17:0/17:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/17:0/18:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/17:0/a-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/17:0/a-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/17:0/a-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/17:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/17:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/17:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/17:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/17:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/17:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/17:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/17:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/17:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/17:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/17:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/17:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/18:0/18:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/18:0/a-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/18:0/a-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/18:0/a-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/18:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/18:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/18:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/18:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/18:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/18:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/18:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/18:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/18:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/18:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/18:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/18:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/a-13:0/a-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/a-13:0/a-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/a-13:0/a-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/a-13:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/a-13:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/a-13:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/a-13:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/a-13:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/a-13:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/a-13:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/a-13:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/a-13:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/a-13:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/a-13:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/a-13:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/a-15:0/a-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/a-15:0/a-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/a-15:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/a-15:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/a-15:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/a-15:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/a-15:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/a-15:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/a-15:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/a-15:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/a-15:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/a-15:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/a-15:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/a-15:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/a-17:0/a-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/a-17:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/a-17:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/a-17:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/a-17:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/a-17:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/a-17:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/a-17:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/a-17:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/a-17:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/a-17:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/a-17:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/a-17:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/a-25:0/10:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/a-25:0/12:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/a-25:0/13:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/a-25:0/14:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/a-25:0/15:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/a-25:0/16:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/a-25:0/17:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/a-25:0/18:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/a-25:0/a-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/a-25:0/a-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/a-25:0/a-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/a-25:0/a-25:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/a-25:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/a-25:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/a-25:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/a-25:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/a-25:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/a-25:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/a-25:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/a-25:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/a-25:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/a-25:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/a-25:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/a-25:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/i-12:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/i-12:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/i-12:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/i-12:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/i-12:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/i-12:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/i-12:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/i-12:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/i-12:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/i-12:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/i-12:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/i-12:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/i-13:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/i-13:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/i-13:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/i-13:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/i-13:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/i-13:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/i-13:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/i-13:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/i-13:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/i-13:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/i-13:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/i-14:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/i-14:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/i-14:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/i-14:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/i-14:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/i-14:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/i-14:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/i-14:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/i-14:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/i-14:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/i-15:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/i-15:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/i-15:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/i-15:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/i-15:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/i-15:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/i-15:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/i-15:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/i-15:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/i-16:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/i-16:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/i-16:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/i-16:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/i-16:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/i-16:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/i-16:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/i-16:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/i-17:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/i-17:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/i-17:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/i-17:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/i-17:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/i-17:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/i-17:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/i-18:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/i-18:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/i-18:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/i-18:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/i-18:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/i-18:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/i-19:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/i-19:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/i-19:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/i-19:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/i-19:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/i-20:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/i-20:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/i-20:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/i-20:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/i-21:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/i-21:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/i-21:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/i-22:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/i-22:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(a-25:0/i-24:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-19:0/i-19:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-19:0/i-19:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-19:0/i-19:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-19:0/i-19:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-19:0/i-20:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-19:0/i-20:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-19:0/i-20:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-19:0/i-20:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-19:0/i-21:0/12:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-19:0/i-21:0/13:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-19:0/i-21:0/14:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-19:0/i-21:0/15:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-19:0/i-21:0/16:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-19:0/i-21:0/17:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-19:0/i-21:0/18:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-19:0/i-21:0/a-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-19:0/i-21:0/a-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-19:0/i-21:0/a-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-19:0/i-21:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-19:0/i-21:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-19:0/i-21:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-19:0/i-21:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-19:0/i-21:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-19:0/i-21:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-19:0/i-21:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-19:0/i-21:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-19:0/i-21:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-19:0/i-21:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-19:0/i-22:0/12:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-19:0/i-22:0/13:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-19:0/i-22:0/14:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-19:0/i-22:0/15:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-19:0/i-22:0/16:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-19:0/i-22:0/17:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-19:0/i-22:0/18:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-19:0/i-22:0/a-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-19:0/i-22:0/a-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-19:0/i-22:0/a-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-19:0/i-22:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-19:0/i-22:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-19:0/i-22:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-19:0/i-22:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-19:0/i-22:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-19:0/i-22:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-19:0/i-22:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-19:0/i-22:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-19:0/i-22:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-19:0/i-24:0/12:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-19:0/i-24:0/13:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-19:0/i-24:0/14:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-19:0/i-24:0/15:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-19:0/i-24:0/16:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-19:0/i-24:0/17:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-19:0/i-24:0/18:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-19:0/i-24:0/a-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-19:0/i-24:0/a-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-19:0/i-24:0/a-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-19:0/i-24:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-19:0/i-24:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-19:0/i-24:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-19:0/i-24:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-19:0/i-24:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-19:0/i-24:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-19:0/i-24:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-19:0/i-24:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/12:0/12:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/12:0/13:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/12:0/14:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/12:0/15:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/12:0/16:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/12:0/17:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/12:0/18:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/12:0/19:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/12:0/a-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/12:0/a-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/12:0/a-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/12:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/12:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/12:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/12:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/12:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/12:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/12:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/12:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/12:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/12:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/12:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/13:0/13:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/13:0/14:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/13:0/15:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/13:0/16:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/13:0/17:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/13:0/18:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/13:0/19:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/13:0/a-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/13:0/a-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/13:0/a-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/13:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/13:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/13:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/13:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/13:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/13:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/13:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/13:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/13:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/13:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/13:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/14:0/14:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/14:0/15:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/14:0/16:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/14:0/17:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/14:0/18:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/14:0/19:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/14:0/a-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/14:0/a-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/14:0/a-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/14:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/14:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/14:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/14:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/14:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/14:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/14:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/14:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/14:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/14:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/14:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/15:0/15:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/15:0/16:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/15:0/17:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/15:0/18:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/15:0/19:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/15:0/a-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/15:0/a-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/15:0/a-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/15:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/15:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/15:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/15:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/15:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/15:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/15:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/15:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/15:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/15:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/15:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/16:0/16:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/16:0/17:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/16:0/18:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/16:0/19:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/16:0/a-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/16:0/a-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/16:0/a-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/16:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/16:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/16:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/16:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/16:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/16:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/16:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/16:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/16:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/16:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/16:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/17:0/17:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/17:0/18:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/17:0/19:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/17:0/a-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/17:0/a-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/17:0/a-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/17:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/17:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/17:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/17:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/17:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/17:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/17:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/17:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/17:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/17:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/17:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/18:0/18:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/18:0/19:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/18:0/a-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/18:0/a-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/18:0/a-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/18:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/18:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/18:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/18:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/18:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/18:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/18:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/18:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/18:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/18:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/18:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/19:0/19:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/19:0/a-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/19:0/a-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/19:0/a-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/19:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/19:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/19:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/19:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/19:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/19:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/19:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/19:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/a-13:0/a-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/a-13:0/a-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/a-13:0/a-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/a-13:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/a-13:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/a-13:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/a-13:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/a-13:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/a-13:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/a-13:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/a-13:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/a-13:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/a-13:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/a-13:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/a-15:0/a-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/a-15:0/a-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/a-15:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/a-15:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/a-15:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/a-15:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/a-15:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/a-15:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/a-15:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/a-15:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/a-15:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/a-15:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/a-15:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/a-17:0/a-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/a-17:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/a-17:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/a-17:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/a-17:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/a-17:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/a-17:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/a-17:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/a-17:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/a-17:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/a-17:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/a-17:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/i-12:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/i-12:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/i-12:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/i-12:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/i-12:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/i-12:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/i-12:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/i-12:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/i-12:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/i-12:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/i-12:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/i-13:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/i-13:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/i-13:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/i-13:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/i-13:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/i-13:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/i-13:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/i-13:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/i-13:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/i-13:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/i-14:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/i-14:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/i-14:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/i-14:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/i-14:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/i-14:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/i-14:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/i-14:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/i-14:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/i-15:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/i-15:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/i-15:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/i-15:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/i-15:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/i-15:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/i-15:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/i-15:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/i-16:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/i-16:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/i-16:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/i-16:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/i-16:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/i-16:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/i-16:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/i-17:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/i-17:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/i-17:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/i-17:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/i-17:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/i-17:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/i-18:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/i-18:0/i-19:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/i-18:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/i-18:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/i-18:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/i-20:0/12:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/i-20:0/13:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/i-20:0/14:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/i-20:0/15:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/i-20:0/16:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/i-20:0/17:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/i-20:0/18:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/i-20:0/a-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/i-20:0/a-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/i-20:0/a-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/i-20:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/i-20:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/i-20:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/i-20:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/i-20:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/i-20:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/i-20:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/i-20:0/i-20:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/i-20:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/i-20:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/i-20:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/i-21:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/i-21:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/i-21:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/i-22:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/i-22:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-20:0/i-24:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/12:0/12:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/12:0/13:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/12:0/14:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/12:0/15:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/12:0/16:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/12:0/17:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/12:0/18:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/12:0/a-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/12:0/a-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/12:0/a-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/12:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/12:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/12:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/12:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/12:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/12:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/12:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/12:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/12:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/13:0/13:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/13:0/14:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/13:0/15:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/13:0/16:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/13:0/17:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/13:0/18:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/13:0/a-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/13:0/a-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/13:0/a-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/13:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/13:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/13:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/13:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/13:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/13:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/13:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/13:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/13:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/14:0/14:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/14:0/15:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/14:0/16:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/14:0/17:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/14:0/18:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/14:0/a-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/14:0/a-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/14:0/a-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/14:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/14:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/14:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/14:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/14:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/14:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/14:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/14:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/14:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/15:0/15:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/15:0/16:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/15:0/17:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/15:0/18:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/15:0/a-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/15:0/a-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/15:0/a-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/15:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/15:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/15:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/15:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/15:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/15:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/15:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/15:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/15:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/16:0/16:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/16:0/17:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/16:0/18:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/16:0/a-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/16:0/a-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/16:0/a-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/16:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/16:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/16:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/16:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/16:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/16:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/16:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/16:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/16:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/17:0/17:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/17:0/18:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/17:0/a-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/17:0/a-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/17:0/a-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/17:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/17:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/17:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/17:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/17:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/17:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/17:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/17:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/17:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/18:0/18:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/18:0/a-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/18:0/a-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/18:0/a-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/18:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/18:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/18:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/18:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/18:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/18:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/18:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/18:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/18:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/a-13:0/a-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/a-13:0/a-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/a-13:0/a-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/a-13:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/a-13:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/a-13:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/a-13:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/a-13:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/a-13:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/a-13:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/a-13:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/a-13:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/a-15:0/a-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/a-15:0/a-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/a-15:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/a-15:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/a-15:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/a-15:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/a-15:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/a-15:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/a-15:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/a-15:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/a-15:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/a-17:0/a-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/a-17:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/a-17:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/a-17:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/a-17:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/a-17:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/a-17:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/a-17:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/a-17:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/a-17:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/i-12:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/i-12:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/i-12:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/i-12:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/i-12:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/i-12:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/i-12:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/i-12:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/i-12:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/i-13:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/i-13:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/i-13:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/i-13:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/i-13:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/i-13:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/i-13:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/i-13:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/i-14:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/i-14:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/i-14:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/i-14:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/i-14:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/i-14:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/i-14:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/i-15:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/i-15:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/i-15:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/i-15:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/i-15:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/i-15:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/i-16:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/i-16:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/i-16:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/i-16:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/i-16:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/i-17:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/i-17:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/i-17:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/i-17:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/i-18:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/i-18:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/i-18:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/i-21:0/12:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/i-21:0/13:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/i-21:0/14:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/i-21:0/15:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/i-21:0/16:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/i-21:0/17:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/i-21:0/18:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/i-21:0/a-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/i-21:0/a-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/i-21:0/a-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/i-21:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/i-21:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/i-21:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/i-21:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/i-21:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/i-21:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/i-21:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/i-21:0/i-21:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/i-21:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/i-21:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/i-22:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/i-22:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-21:0/i-24:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/12:0/12:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/12:0/13:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/12:0/14:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/12:0/15:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/12:0/16:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/12:0/17:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/12:0/18:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/12:0/a-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/12:0/a-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/12:0/a-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/12:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/12:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/12:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/12:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/12:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/12:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/12:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/12:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/13:0/13:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/13:0/14:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/13:0/15:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/13:0/16:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/13:0/17:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/13:0/18:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/13:0/a-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/13:0/a-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/13:0/a-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/13:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/13:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/13:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/13:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/13:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/13:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/13:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/13:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/14:0/14:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/14:0/15:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/14:0/16:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/14:0/17:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/14:0/18:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/14:0/a-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/14:0/a-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/14:0/a-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/14:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/14:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/14:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/14:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/14:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/14:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/14:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/14:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/15:0/15:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/15:0/16:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/15:0/17:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/15:0/18:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/15:0/a-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/15:0/a-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/15:0/a-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/15:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/15:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/15:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/15:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/15:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/15:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/15:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/15:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/16:0/16:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/16:0/17:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/16:0/18:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/16:0/a-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/16:0/a-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/16:0/a-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/16:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/16:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/16:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/16:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/16:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/16:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/16:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/16:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/17:0/17:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/17:0/18:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/17:0/a-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/17:0/a-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/17:0/a-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/17:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/17:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/17:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/17:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/17:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/17:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/17:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/17:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/18:0/18:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/18:0/a-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/18:0/a-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/18:0/a-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/18:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/18:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/18:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/18:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/18:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/18:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/18:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/18:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/a-13:0/a-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/a-13:0/a-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/a-13:0/a-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/a-13:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/a-13:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/a-13:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/a-13:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/a-13:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/a-13:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/a-13:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/a-13:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/a-15:0/a-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/a-15:0/a-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/a-15:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/a-15:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/a-15:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/a-15:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/a-15:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/a-15:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/a-15:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/a-15:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/a-17:0/a-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/a-17:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/a-17:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/a-17:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/a-17:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/a-17:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/a-17:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/a-17:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/a-17:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/i-12:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/i-12:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/i-12:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/i-12:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/i-12:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/i-12:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/i-12:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/i-12:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/i-13:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/i-13:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/i-13:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/i-13:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/i-13:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/i-13:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/i-13:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/i-14:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/i-14:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/i-14:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/i-14:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/i-14:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/i-14:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/i-15:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/i-15:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/i-15:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/i-15:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/i-15:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/i-16:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/i-16:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/i-16:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/i-16:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/i-17:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/i-17:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/i-17:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/i-18:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/i-18:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/i-22:0/12:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/i-22:0/13:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/i-22:0/14:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/i-22:0/15:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/i-22:0/16:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/i-22:0/17:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/i-22:0/18:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/i-22:0/a-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/i-22:0/a-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/i-22:0/a-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/i-22:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/i-22:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/i-22:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/i-22:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/i-22:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/i-22:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/i-22:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/i-22:0/i-22:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/i-22:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-22:0/i-24:0/i-24:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/12:0/12:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/12:0/13:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/12:0/14:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/12:0/15:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/12:0/16:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/12:0/17:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/12:0/18:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/12:0/a-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/12:0/a-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/12:0/a-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/12:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/12:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/12:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/12:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/12:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/12:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/12:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/13:0/13:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/13:0/14:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/13:0/15:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/13:0/16:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/13:0/17:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/13:0/18:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/13:0/a-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/13:0/a-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/13:0/a-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/13:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/13:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/13:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/13:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/13:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/13:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/13:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/14:0/14:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/14:0/15:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/14:0/16:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/14:0/17:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/14:0/18:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/14:0/a-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/14:0/a-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/14:0/a-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/14:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/14:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/14:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/14:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/14:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/14:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/14:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/15:0/15:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/15:0/16:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/15:0/17:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/15:0/18:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/15:0/a-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/15:0/a-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/15:0/a-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/15:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/15:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/15:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/15:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/15:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/15:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/15:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/16:0/16:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/16:0/17:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/16:0/18:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/16:0/a-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/16:0/a-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/16:0/a-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/16:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/16:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/16:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/16:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/16:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/16:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/16:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/17:0/17:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/17:0/18:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/17:0/a-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/17:0/a-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/17:0/a-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/17:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/17:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/17:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/17:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/17:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/17:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/17:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/18:0/18:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/18:0/a-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/18:0/a-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/18:0/a-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/18:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/18:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/18:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/18:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/18:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/18:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/18:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/a-13:0/a-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/a-13:0/a-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/a-13:0/a-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/a-13:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/a-13:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/a-13:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/a-13:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/a-13:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/a-13:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/a-13:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/a-15:0/a-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/a-15:0/a-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/a-15:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/a-15:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/a-15:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/a-15:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/a-15:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/a-15:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/a-15:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/a-17:0/a-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/a-17:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/a-17:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/a-17:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/a-17:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/a-17:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/a-17:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/a-17:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/i-12:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/i-12:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/i-12:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/i-12:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/i-12:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/i-12:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/i-12:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/i-13:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/i-13:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/i-13:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/i-13:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/i-13:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/i-13:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/i-14:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/i-14:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/i-14:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/i-14:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/i-14:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/i-15:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/i-15:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/i-15:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/i-15:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/i-16:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/i-16:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/i-16:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/i-17:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/i-17:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/i-18:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/i-24:0/12:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/i-24:0/13:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/i-24:0/14:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/i-24:0/15:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/i-24:0/16:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/i-24:0/17:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/i-24:0/18:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/i-24:0/a-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/i-24:0/a-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/i-24:0/a-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/i-24:0/i-12:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/i-24:0/i-13:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/i-24:0/i-14:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/i-24:0/i-15:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/i-24:0/i-16:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/i-24:0/i-17:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/i-24:0/i-18:0)
  • De Novo Triacylglycerol Biosynthesis TG(i-24:0/i-24:0/i-24:0)
  • Glycerophospholipid metabolism
  • Membrane lipid metabolism
  • Plasmalogen Synthesis
Reactions
Glycerol 3-phosphate + Long-chain fatty acyl-CoA → 1-Acyl-sn-glycerol 3-phosphate + Coenzyme A details
Palmityl-CoA + Glycerol 3-phosphate → Coenzyme A + LPA(16:0/0:0) details
Stearoyl-CoA + Glycerol 3-phosphate → Coenzyme A + LPA(18:0/0:0) details
Oleoyl-CoA + Glycerol 3-phosphate → Coenzyme A + LysoPA(18:1(9Z)/0:0) details
Gamma-linolenoyl-CoA + Glycerol 3-phosphate → Coenzyme A + LysoPA(18:3(6Z,9Z,12Z)/0:0) details
Eicosanoyl-CoA + Glycerol 3-phosphate → Coenzyme A + LysoPA(20:0/0:0) details
Gondoyl-CoA + Glycerol 3-phosphate → Coenzyme A + LysoPA(20:1(11Z)/0:0) details
Docosanoyl-CoA + Glycerol 3-phosphate → Coenzyme A + LysoPA(22:0/0:0) details
Erucoyl-CoA + Glycerol 3-phosphate → Coenzyme A + LysoPA(22:1(13Z)/0:0) details
Eicosanoyl-CoA + Dihydroxyacetone phosphate → DHAP(18:0) + Coenzyme A details
DHAP(18:0) + Octadecanol → DHAP(18:0e) + Stearic acid details
GO Classification Not Available
Cellular Location Not Available
Gene Properties
Chromosome Location Not Available
Locus Not Available
SNPs GNPAT
Gene Sequence
>2043 bp
ATGGATCATTCCAGTTCATCCAACTCTTGTTTCTCCGTTGGCTCCACCAGTCCCGGGGCT
GTCGTGCTTCTCTACTCGAAAGAGCTCAAAAAGTGGGATGAGTTTGAAGATGTTTTAGAG
GAGAGGAGGCATGTCAGTGACTTGAAGTTTGCAATGAAATGCTACACACCTCTTGTCTAT
AAGGGAATTACTCCTTGTAAGCCAAGTGATATTAAATGTAGTGTTCTCAATTCTGAAGAG
ATTCATTATGTCATTAAACAGCTTTCCAAGGAATCCCTTCAACCTGTCGAGGTCCTCCGA
GAGGAAGCCTGTGAGATCCTGGATGAAATGAGCCACAAGCTGCGTCTAGGAGCCATTCGG
TTTTTTGCCTTTGCCCTGAGTAAAATATTTAAACAGATTTTCTCAAAAGTGCGTGTAAAT
GAAGAAGGGATTCAGAAACTCCAGCGAGCCATCCAGGAGCATCCAGTTGTCCTGCTGCCC
AGTCATCGGAGCTACATCGACTTTCTGATGTTGTCTTTCCTTTTGTACAACTATGACTTA
CCTGTGCCGGTCATAGCAGCAGGAATGGACTTCCTGGGAATGAAGATGGTTGGTGAGCTG
CTGCGGATGTCGGGGGCTTTCTTCATGCGGCGCACCTTTGGTGGCAATAAGCTCTACTGG
GCCGTGTTCTCCGAATATGTGAAAACCATGTTACGGAATGGTTATGCTCCTGTTGAATTT
TTCCTCGAAGGGACAAGAAGCCGCTCTGCCAAGACATTGACTCCAAAATTTGGTCTTCTA
AATATTGTGATGGAACCATTTTTTAAAAGAGAAGTTTTTGATACCTACCTTGTTCCAATC
AGCATCAGTTACGATAGGATATTGGAAGAAACTCTGTATGCATATGAGCTTCTAGGGGTT
CCTAAGCCAAAAGAATCTACAACTGGATTGTTGAAAGCCAGGAGAATCCTCTCTGAGAAG
TTTGGAAACATTCATGTGTACTTTGGAGACCCTGTGTCGCTTCGATCTCTGGCCGCTGGG
AGGATGGGGCGGAGCCCGTATAACTTGGTTCCCAGATATATTCCTCAGAAACAGTCAGAG
GAGATGCACACCTTTGTGACTGAAGTTGCCTATAAAATGCAGCTTCTCCAAATTCAAAAC
CTGGTCCTGAGCCCGTGGCCGCTAATAGTTGCTGTCCTGCTTCAGAACCGGCCATCCATA
GACTTTGATGCCCTGTTGGAAAAAACTTTATGGCTGAAAGGCTTAACCCAGGCCTTCGGG
GGGTTTCTTACTTGGCCTGATAATGAACCTGCTGAAGCAGTTATCCAGTCCAGCATTCTT
CTGCATTCCAACATCGTCAGCCTCGTCAAAGACCGGGTGATTCTGAAAATGGAGTGCGGA
GACTCGGAACTGGTGGATGGACTCATTTTCCAGCATATCACCCTCCTCATGTGCTTGGCA
TACAGGAACCAGCTGCTCAACGTTTTTGTCCGTCCGTCCTTAGTCGCTATGGCATTGCAG
ATGACACCTGGGTTCAGGAAAGAGGATGTCTACAGTTGCTTTCGCTTCCTATGCAGTGTT
TTTTCAGATGAGTTCATCTTTCTTCCAGGAAATGCACTAAAGGACTTTGAAGAAGGCTGT
TACTTGCTTTGTAAGAGTGAGGCCATACAAGTGATGACGAGGGACATCCTAGTTACAGAA
AAAGGAAATTCTGTGTTAGAGTTTTTAATAGGACTTTTTAAACCTTTTGTGGAATCTTAT
CAGATAATTTGCAAATACCTCTTGAACGAAGAAGAAGACTACTTCACTGAGAAACAGTAC
TTCATAAGAGTTAGAAAATTCACAAGTCAGCTTCTCGATCAAGGGGCCTCACAGTGTTAC
GATGTATTATCCTCCGACGTACAGAAAAATGCCTTAGCAGCTTTTGTGAGGCTCGGTGTG
GTGGAGAAGAAGAAGGTAAATAATGATTATATATTTAACGTGAACGAACCTGCCACAACA
AAGTTAGAGGAAATGCTTGGTTGTAAAACACCAGTAGGAAAACCAGCAACTGCGAAGCTT
TAA
Protein Properties
Number of Residues 680
Molecular Weight 77664.0
Theoretical pI 7.6
Pfam Domain Function Not Available
Signals
  • None
Transmembrane Regions Not Available
Protein Sequence
>Dihydroxyacetone phosphate acyltransferase
MDHSSSSNSCFSVGSTSPGAVVLLYSKELKKWDEFEDVLEERRHVSDLKFAMKCYTPLVY
KGITPCKPSDIKCSVLNSEEIHYVIKQLSKESLQPVEVLREEACEILDEMSHKLRLGAIR
FFAFALSKIFKQIFSKVRVNEEGIQKLQRAIQEHPVVLLPSHRSYIDFLMLSFLLYNYDL
PVPVIAAGMDFLGMKMVGELLRMSGAFFMRRTFGGNKLYWAVFSEYVKTMLRNGYAPVEF
FLEGTRSRSAKTLTPKFGLLNIVMEPFFKREVFDTYLVPISISYDRILEETLYAYELLGV
PKPKESTTGLLKARRILSEKFGNIHVYFGDPVSLRSLAAGRMGRSPYNLVPRYIPQKQSE
EMHTFVTEVAYKMQLLQIQNLVLSPWPLIVAVLLQNRPSIDFDALLEKTLWLKGLTQAFG
GFLTWPDNEPAEAVIQSSILLHSNIVSLVKDRVILKMECGDSELVDGLIFQHITLLMCLA
YRNQLLNVFVRPSLVAMALQMTPGFRKEDVYSCFRFLCSVFSDEFIFLPGNALKDFEEGC
YLLCKSEAIQVMTRDILVTEKGNSVLEFLIGLFKPFVESYQIICKYLLNEEEDYFTEKQY
FIRVRKFTSQLLDQGASQCYDVLSSDVQKNALAAFVRLGVVEKKKVNNDYIFNVNEPATT
KLEEMLGCKTPVGKPATAKL
GenBank ID Protein AAI34456.1
UniProtKB/Swiss-Prot ID A4IF87
UniProtKB/Swiss-Prot Entry Name GNPAT_BOVIN
PDB IDs Not Available
GenBank Gene ID BC134455
GeneCard ID GNPAT
GenAtlas ID Not Available
HGNC ID Not Available
References
General References Not Available