You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Bovine Metabolome Database.
Showing Protein Similar to aspartate aminotransferase (BMDBP00217)
| Identification | |
|---|---|
| BMDB Protein ID | BMDBP00217 |
| Secondary Accession Numbers | None |
| Name | Similar to aspartate aminotransferase |
| Synonyms | Not Available |
| Gene Name | Not Available |
| Protein Type | Enzyme |
| Biological Properties | |
| General Function | Amino acid transport and metabolism |
| Specific Function | Not Available |
| Pathways | Not Available |
| Reactions | Not Available |
| GO Classification | Not Available |
| Cellular Location | Not Available |
| Gene Properties | |
| Chromosome Location | 18 |
| Locus | Not Available |
| SNPs | Not Available |
| Gene Sequence | Not Available |
| Protein Properties | |
| Number of Residues | 173 |
| Molecular Weight | 18638.0 |
| Theoretical pI | 10.13 |
| Pfam Domain Function | Not Available |
| Signals |
|
| Transmembrane Regions | Not Available |
| Protein Sequence |
>Similar to aspartate aminotransferase MALLHSGRFLSGVAAAFHPGLAAAASARASSWWAHVEMGPPDPILGVTEAFKRDTNSKKM NLGVGAYRDDNGKPYVLPSVRKAEAQIAAKNLDKEYLPIAGLAEFCKASAELALGENNEV LKSGRYVTVQTISGTGALRIGASFLQRFFKFSRDVFLPKTTWGNHTPIFRDAG |
| External Links | |
| GenBank ID Protein | BAC56407.1 |
| UniProtKB/Swiss-Prot ID | Q862R2 |
| UniProtKB/Swiss-Prot Entry Name | Q862R2_BOVIN |
| PDB IDs | Not Available |
| GenBank Gene ID | AB098917 |
| GeneCard ID | Not Available |
| GenAtlas ID | Not Available |
| HGNC ID | Not Available |
| References | |
| General References | Not Available |