You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Bovine Metabolome Database.
Showing Protein Glutamate decarboxylase (BMDBP00220)
| Identification | |
|---|---|
| BMDB Protein ID | BMDBP00220 |
| Secondary Accession Numbers | None |
| Name | Glutamate decarboxylase |
| Synonyms | Not Available |
| Gene Name | GAD2 |
| Protein Type | Enzyme |
| Biological Properties | |
| General Function | Involved in carboxy-lyase activity |
| Specific Function | Not Available |
| Pathways | Not Available |
| Reactions | Not Available |
| GO Classification | Not Available |
| Cellular Location | Not Available |
| Gene Properties | |
| Chromosome Location | 13 |
| Locus | Not Available |
| SNPs | GAD2 |
| Gene Sequence | Not Available |
| Protein Properties | |
| Number of Residues | 31 |
| Molecular Weight | 3688.0 |
| Theoretical pI | 4.7 |
| Pfam Domain Function | Not Available |
| Signals |
|
| Transmembrane Regions | Not Available |
| Protein Sequence |
>Glutamate decarboxylase CLELAEYLYNIIKNREGYEMVFDGKPQHTNV |
| External Links | |
| GenBank ID Protein | ABA10590.1 |
| UniProtKB/Swiss-Prot ID | B6A7R2 |
| UniProtKB/Swiss-Prot Entry Name | B6A7R2_BOVIN |
| PDB IDs | Not Available |
| GenBank Gene ID | DQ139317 |
| GeneCard ID | GAD2 |
| GenAtlas ID | Not Available |
| HGNC ID | Not Available |
| References | |
| General References | Not Available |