You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Bovine Metabolome Database.
Identification
BMDB Protein ID BMDBP00220
Secondary Accession Numbers None
Name Glutamate decarboxylase
Synonyms Not Available
Gene Name GAD2
Protein Type Enzyme
Biological Properties
General Function Involved in carboxy-lyase activity
Specific Function Not Available
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location Not Available
Gene Properties
Chromosome Location 13
Locus Not Available
SNPs GAD2
Gene Sequence Not Available
Protein Properties
Number of Residues 31
Molecular Weight 3688.0
Theoretical pI 4.7
Pfam Domain Function Not Available
Signals
  • None
Transmembrane Regions Not Available
Protein Sequence
>Glutamate decarboxylase
CLELAEYLYNIIKNREGYEMVFDGKPQHTNV
GenBank ID Protein ABA10590.1
UniProtKB/Swiss-Prot ID B6A7R2
UniProtKB/Swiss-Prot Entry Name B6A7R2_BOVIN
PDB IDs Not Available
GenBank Gene ID DQ139317
GeneCard ID GAD2
GenAtlas ID Not Available
HGNC ID Not Available
References
General References Not Available