You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Bovine Metabolome Database.
Showing Protein 14-3-3 protein gamma (BMDBP00242)
Identification | |
---|---|
BMDB Protein ID | BMDBP00242 |
Secondary Accession Numbers | None |
Name | 14-3-3 protein gamma |
Synonyms | Not Available |
Gene Name | YWHAG |
Protein Type | Enzyme |
Biological Properties | |
General Function | Involved in insulin-like growth factor receptor binding |
Specific Function | Adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathways. Binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Binding generally results in the modulation of the activity of the binding partner. |
Pathways | Not Available |
Reactions | Not Available |
GO Classification | Not Available |
Cellular Location | Not Available |
Gene Properties | |
Chromosome Location | 25 |
Locus | Not Available |
SNPs | YWHAG |
Gene Sequence | Not Available |
Protein Properties | |
Number of Residues | 247 |
Molecular Weight | 28253.0 |
Theoretical pI | 4.52 |
Pfam Domain Function | Not Available |
Signals |
|
Transmembrane Regions | Not Available |
Protein Sequence |
>14-3-3 protein gamma MVDREQLVQKARLAEQAERYDDMAAAMKNVTELNEPLSNEERNLLSVAYKNVVGARRSSW RVISSIEQKTSADGNEKKIEMVRAYREKIEKELEAVCQDVLSLLDNYLIKNCSETQIESK VFYLKMKGDYYRYLAEVATGEKRATVVESSEKAYSEAHEISKEHMQPTHPIRLGLALNYS VFYYEIQNAPEQACHLAKTAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDD DGGEGNN |
External Links | |
GenBank ID Protein | AAC02091.1 |
UniProtKB/Swiss-Prot ID | P68252 |
UniProtKB/Swiss-Prot Entry Name | 1433G_BOVIN |
PDB IDs | Not Available |
GenBank Gene ID | AF043737 |
GeneCard ID | YWHAG |
GenAtlas ID | Not Available |
HGNC ID | Not Available |
References | |
General References | Not Available |