Showing Protein 14-3-3 protein gamma (BMDBP00242)
| Identification | |
|---|---|
| BMDB Protein ID | BMDBP00242 |
| Secondary Accession Numbers | None |
| Name | 14-3-3 protein gamma |
| Synonyms | Not Available |
| Gene Name | YWHAG |
| Protein Type | Enzyme |
| Biological Properties | |
| General Function | Involved in insulin-like growth factor receptor binding |
| Specific Function | Adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathways. Binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Binding generally results in the modulation of the activity of the binding partner. |
| Pathways | Not Available |
| Reactions | Not Available |
| GO Classification | Not Available |
| Cellular Location | Not Available |
| Gene Properties | |
| Chromosome Location | 25 |
| Locus | Not Available |
| SNPs | YWHAG |
| Gene Sequence | Not Available |
| Protein Properties | |
| Number of Residues | 247 |
| Molecular Weight | 28253.0 |
| Theoretical pI | 4.52 |
| Pfam Domain Function | Not Available |
| Signals |
|
| Transmembrane Regions | Not Available |
| Protein Sequence |
>14-3-3 protein gamma MVDREQLVQKARLAEQAERYDDMAAAMKNVTELNEPLSNEERNLLSVAYKNVVGARRSSW RVISSIEQKTSADGNEKKIEMVRAYREKIEKELEAVCQDVLSLLDNYLIKNCSETQIESK VFYLKMKGDYYRYLAEVATGEKRATVVESSEKAYSEAHEISKEHMQPTHPIRLGLALNYS VFYYEIQNAPEQACHLAKTAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDD DGGEGNN |
| External Links | |
| GenBank ID Protein | AAC02091.1 |
| UniProtKB/Swiss-Prot ID | P68252 |
| UniProtKB/Swiss-Prot Entry Name | 1433G_BOVIN |
| PDB IDs | Not Available |
| GenBank Gene ID | AF043737 |
| GeneCard ID | YWHAG |
| GenAtlas ID | Not Available |
| HGNC ID | Not Available |
| References | |
| General References | Not Available |