Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Bovine Metabolome Database.
Identification
BMDB Protein ID BMDBP00244
Secondary Accession Numbers None
Name Peroxisomal carnitine O-octanoyltransferase
Synonyms Not Available
Gene Name CROT
Protein Type Enzyme
Biological Properties
General Function Involved in carnitine O-octanoyltransferase activity
Specific Function Beta-oxidation of fatty acids. The highest activity concerns the C6 to C10 chain length substrate.
Pathways
  • Beta Oxidation of Very Long Chain Fatty Acids
  • Fatty acid beta-oxidation
  • Lipid metabolism
  • Oxidation of Branched-Chain Fatty Acids
  • Phospholipid Biosynthesis
Reactions
Choline → Acetylcholine details
Acetyl-CoA + L-Carnitine → L-Acetylcarnitine + Coenzyme A details
Lauroyl-CoA → Coenzyme A + Dodecanoic acid details
L-Acetylcarnitine + L-Carnitine → Acetyl-CoA + Coenzyme A details
GO Classification Not Available
Cellular Location Not Available
Gene Properties
Chromosome Location 4
Locus Not Available
SNPs CROT
Gene Sequence
>1839 bp
ATGGAAAATCAACTGGCTAAATCAACTGAAGAAAGGACATTTCAGTACCAAGATTCCCTT
CCATCGCTGCCTGTTCCTTCACTTGAAGAATCATTAAAAAAATACCTTGAATCAGTAAAG
CCATTTGCAAATGAGGAAGAATATAAGAATACTGAAGCAATTGTCTGGAAATTTCAAAAT
GGCATTGGAGAAAAATTGCAGCAGAAATTACTTCAAAGAGCAAAAGGAAGAAGAAACTGG
CTGGAAGAGTGGTGGCTGAATGTTGCCTACCTGGATGTTCGTATACCATCACAACTGAAT
GTCAACTTTGGGGGTCCTGCAAGCCATATTGAACACTACTGGCCTCCAAAGGAAGGCACA
CAGTTGGAAAGAGGAAGTATAAGTCTTTGGCATAACTTGAACTACTGGCAGCTATTAAGA
AAAGAAAAGTTAGCTGTTGAAAAAGTTGGAAATACTCCTCTAGATATGAATCAATTCCGA
ATGCTGTTTTCCACCTGCAAGATTCCAGGAATTACTAGAGATTCAATTATTAATTATTTT
AGGACTGAGAGTGAAGGACATTCTCCAAGTCACCTTGCAGTGTTGTGTCGAGGCCGAGTT
TTTGTCTTTGATGTAATGCATGAGGGATATCTGATGACTGCACCAGAGATTCAGAGGCAA
TTGACATACATCCAAAAGAAATGCCACAGTGAACCCGACGGACCTGGGGTAGCAGCGTTA
ACTACTGAGGAGCGAACTCGATGGGCTAAGGCACGAGAATATTTGATTAGTCTTAATCCA
GAGAACCTGACTATATTAGAAAAAATTCAGAGCAGTTTACTGGTATTTTGTTTAGATGAT
GACAGTCCACATGTTACACCAGAAGATTATTCTCAGGTTTCTGCAAAGATTCTTAATGGA
GACCCAACAGTACGCTGGGGTGACAAATCTTATAACTTGATTGCCTTTTCTAATGGAGTA
TTTGGCAGTAATTGTGATCATGCTCCTTTTGATGCAATGGTTCTGGTAAAAGTCTGCTAT
TATGTTGATGAGAACATTCTTGAGAATGAAGGAAGATGGAAGGGCTCAGAAAAAGTACGG
GATATACCGGTTCCAGAGGAGCTTGTTTTCACTGTGGATGAAAAAGTATTAAATGACATC
AACCAAGCTAAGGCCCAGTATTTCAAGCAGGTGTCCGATCTCCAGCTTGTGGTATATGCC
TTTACGTCTTTTGGCAAAAAGCTAACCAAGGAGAAGCAGCTTCACCCTGATACATTTATT
CAGCTGGCACTTCAGTTGGCCTATTACAGACTTCATGGACGTCCTGGTTGCTGCTATGAA
ACAGCTATGACAAGATTATTTTATCATGGCCGTACAGAGACTGTGCGACCATGTACAGTA
GAAGCAGTCAATTGGTGCCAATCCATGCAGAATCCTTCTACCAGTCTTCTTGAGCGGAAG
CACATGATGTTAGAAGCTTTTGCAAAACATAATAAAATGATGAAAGATTGTTCAACTGGA
AAAGGATTTGACCGTCATCTCTTAGGCCTCTCACTCATAGCAAAGGAGGAAGGCCTCCCT
GTTCCAGAACTCTTCACAGACCCCCTCTTCTCCAGGAGTGGAGGAGGTGGAAACTTTGTT
CTCTCAACCAGTCTGGTTGGTTATTTAAGAGTCCAGGGCGTGATGGTTCCCATGGTGCAC
AATGGCTATGGATTCTTCTATCATATCAGAGATGACAGGTTTGTTGTGTCCTGTTCAGCC
TGGAAATCATGTCCAGAGACTGATGCAGAGAAGCTAGTTCAGCAGGTTTTTCATGCTTTC
TGTGATATGATGCAACTGATGGAAATGCCTCATCTCTAG
Protein Properties
Number of Residues 612
Molecular Weight 70263.0
Theoretical pI 6.72
Pfam Domain Function Not Available
Signals
  • None
Transmembrane Regions Not Available
Protein Sequence
>Peroxisomal carnitine O-octanoyltransferase
MENQLAKSTEERTFQYQDSLPSLPVPSLEESLKKYLESVKPFANEEEYKNTEAIVWKFQN
GIGEKLQQKLLQRAKGRRNWLEEWWLNVAYLDVRIPSQLNVNFGGPASHIEHYWPPKEGT
QLERGSISLWHNLNYWQLLRKEKLAVEKVGNTPLDMNQFRMLFSTCKIPGITRDSIINYF
RTESEGHSPSHLAVLCRGRVFVFDVMHEGYLMTAPEIQRQLTYIQKKCHSEPDGPGVAAL
TTEERTRWAKAREYLISLNPENLTILEKIQSSLLVFCLDDDSPHVTPEDYSQVSAKILNG
DPTVRWGDKSYNLIAFSNGVFGSNCDHAPFDAMVLVKVCYYVDENILENEGRWKGSEKVR
DIPVPEELVFTVDEKVLNDINQAKAQYFKQVSDLQLVVYAFTSFGKKLTKEKQLHPDTFI
QLALQLAYYRLHGRPGCCYETAMTRLFYHGRTETVRPCTVEAVNWCQSMQNPSTSLLERK
HMMLEAFAKHNKMMKDCSTGKGFDRHLLGLSLIAKEEGLPVPELFTDPLFSRSGGGGNFV
LSTSLVGYLRVQGVMVPMVHNGYGFFYHIRDDRFVVSCSAWKSCPETDAEKLVQQVFHAF
CDMMQLMEMPHL
GenBank ID Protein AAC48758.1
UniProtKB/Swiss-Prot ID O19094
UniProtKB/Swiss-Prot Entry Name OCTC_BOVIN
PDB IDs Not Available
GenBank Gene ID U65745
GeneCard ID CROT
GenAtlas ID Not Available
HGNC ID Not Available
References
General References Not Available