You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Bovine Metabolome Database.
Showing Protein Creatine kinase M-type (BMDBP00258)
Identification | |
---|---|
BMDB Protein ID | BMDBP00258 |
Secondary Accession Numbers | None |
Name | Creatine kinase M-type |
Synonyms | Not Available |
Gene Name | CKM |
Protein Type | Enzyme |
Biological Properties | |
General Function | Involved in ATP binding |
Specific Function | Reversibly catalyzes the transfer of phosphate between ATP and various phosphogens (e.g. creatine phosphate). Creatine kinase isoenzymes play a central role in energy transduction in tissues with large, fluctuating energy demands, such as skeletal muscle, heart, brain and spermatozoa (By similarity). |
Pathways | Not Available |
Reactions | Not Available |
GO Classification | Not Available |
Cellular Location | Not Available |
Gene Properties | |
Chromosome Location | 18 |
Locus | Not Available |
SNPs | CKM |
Gene Sequence | Not Available |
Protein Properties | |
Number of Residues | 381 |
Molecular Weight | 42989.0 |
Theoretical pI | 7.14 |
Pfam Domain Function | Not Available |
Signals |
|
Transmembrane Regions |
|
Protein Sequence |
>Creatine kinase M-type MPFGNTHNKHKLNFKAEEEYPDLSKHNNHMAKALTLEIYKKLRDKETPSGFTLDDVIQTG VDNPGHPFIMTVGCVAGDEESYTVFKDLFDPIIQDRHGGFKPTDKHKTDLNHENLKGGDD LDPNYVLSSRVRTGRSIKGYALPPHCSRGERRAVEKLSVEALNSLTGEFKGKYYPLKSMT EQEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKSFLVWVNEEDHLRVISM EKGGNMKEVFRRFCVGLQKIEEIFKKAGHPFMWNEHLGYVLTCPSNLGTGLRGGVHVKLA HLSKHPKFEEILTRLRLQKRGTGGVDTAAVGSVFDVSNADRLGSSEVEQVQLVVDGVKLM VEMEKKLEKGQSIDDMIPAQK |
External Links | |
GenBank ID Protein | AAD30974.1 |
UniProtKB/Swiss-Prot ID | Q9XSC6 |
UniProtKB/Swiss-Prot Entry Name | KCRM_BOVIN |
PDB IDs | |
GenBank Gene ID | AF120106 |
GeneCard ID | CKM |
GenAtlas ID | Not Available |
HGNC ID | Not Available |
References | |
General References | Not Available |