Showing Protein NADH-ubiquinone oxidoreductase chain 5 (BMDBP00274)
| Identification | |
|---|---|
| BMDB Protein ID | BMDBP00274 |
| Secondary Accession Numbers | None |
| Name | NADH-ubiquinone oxidoreductase chain 5 |
| Synonyms | Not Available |
| Gene Name | ND5 |
| Protein Type | Enzyme |
| Biological Properties | |
| General Function | Energy production and conversion |
| Specific Function | Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. |
| Pathways | Not Available |
| Reactions | Not Available |
| GO Classification | Not Available |
| Cellular Location | Not Available |
| Gene Properties | |
| Chromosome Location | Not Available |
| Locus | Not Available |
| SNPs | ND5 |
| Gene Sequence | Not Available |
| Protein Properties | |
| Number of Residues | 298 |
| Molecular Weight | 33068.0 |
| Theoretical pI | 9.67 |
| Pfam Domain Function | Not Available |
| Signals |
|
| Transmembrane Regions |
|
| Protein Sequence |
>NADH-ubiquinone oxidoreductase chain 5 PVSALLHSSTMVVAGIFLLIRFYPLTENNKYIQSITLCLGAITTLFTAMCALTQNDIKKI IAFSTSSQLGLMMVTIGINQPYLAFLHICTHAFFKAMLFMCSGSIIHSLNDEQDIRKMGG LFKAMPFTTTALIVGSLALTGMPFLTGFYSKDLIIEAANTSYTNAWALLMTLIATSFTAI YSTRIIFFALLGQPRFPTLVNINENNPLLINSIKRLLIGSLFAGYIISNNIPPTTIPQMT MPYYLKTTALIVTILGFILALEISNMTKNLKYHYPSNAFKFSTLLGYFPTIMHRLAPY |
| External Links | |
| GenBank ID Protein | BAC20244.1 |
| UniProtKB/Swiss-Prot ID | Q8HBP4 |
| UniProtKB/Swiss-Prot Entry Name | Q8HBP4_BOVIN |
| PDB IDs | Not Available |
| GenBank Gene ID | AB090973 |
| GeneCard ID | ND5 |
| GenAtlas ID | Not Available |
| HGNC ID | Not Available |
| References | |
| General References | Not Available |