Identification
BMDB Protein ID BMDBP00281
Secondary Accession Numbers None
Name NADH-ubiquinone oxidoreductase chain 4
Synonyms Not Available
Gene Name ND4
Protein Type Enzyme
Biological Properties
General Function Energy production and conversion
Specific Function Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location Not Available
Gene Properties
Chromosome Location Not Available
Locus Not Available
SNPs ND4
Gene Sequence Not Available
Protein Properties
Number of Residues 134
Molecular Weight 15084.0
Theoretical pI 8.99
Pfam Domain Function Not Available
Signals
  • None
Transmembrane Regions
  • 6-26
  • 47-64
  • 84-103
  • 115-133
Protein Sequence
>NADH-ubiquinone oxidoreductase chain 4
TPNAGLYFLFYTLAGSLPLLVALIYIQNTVGSLNFLMLQYWVQPVHNSWSNVFMWLACMM
AFMVKMPLYGLHLWLPKAHVEAPIAGSMVLAAVLLKLGGYGMLRITLILNPMTDFMAYPF
IMLSLWGMIMTSSI
GenBank ID Protein BAC20234.1
UniProtKB/Swiss-Prot ID Q8HC63
UniProtKB/Swiss-Prot Entry Name Q8HC63_BOVIN
PDB IDs Not Available
GenBank Gene ID AB090963
GeneCard ID ND4
GenAtlas ID Not Available
HGNC ID Not Available
References
General References Not Available