Showing Protein NADH dehydrogenase subunit 5 (BMDBP00322)
Identification | |
---|---|
BMDB Protein ID | BMDBP00322 |
Secondary Accession Numbers | None |
Name | NADH dehydrogenase subunit 5 |
Synonyms | Not Available |
Gene Name | ND5 |
Protein Type | Enzyme |
Biological Properties | |
General Function | Energy production and conversion |
Specific Function | Not Available |
Pathways | Not Available |
Reactions | Not Available |
GO Classification | Not Available |
Cellular Location | Not Available |
Gene Properties | |
Chromosome Location | Not Available |
Locus | Not Available |
SNPs | ND5 |
Gene Sequence | Not Available |
Protein Properties | |
Number of Residues | 95 |
Molecular Weight | 10372.0 |
Theoretical pI | 6.5 |
Pfam Domain Function | Not Available |
Signals |
|
Transmembrane Regions |
|
Protein Sequence |
>NADH-ubiquinone oxidoreductase chain 5 LQAILYNRIGDIGFILAMAWFLTNLNTWDLQQIFMLNPSDSNMPLIGLALAATGKSAQFG LHPWLPSAMEGPTPVSALLHSSTMVVAGIFLLIRF |
External Links | |
GenBank ID Protein | BAC20259.1 |
UniProtKB/Swiss-Prot ID | Q8HAW7 |
UniProtKB/Swiss-Prot Entry Name | Q8HAW7_BOVIN |
PDB IDs | Not Available |
GenBank Gene ID | AB090994 |
GeneCard ID | ND5 |
GenAtlas ID | Not Available |
HGNC ID | Not Available |
References | |
General References | Not Available |