Showing Protein NADH-ubiquinone oxidoreductase chain 2 (BMDBP00338)
Identification | |
---|---|
BMDB Protein ID | BMDBP00338 |
Secondary Accession Numbers | None |
Name | NADH-ubiquinone oxidoreductase chain 2 |
Synonyms | Not Available |
Gene Name | ND2 |
Protein Type | Enzyme |
Biological Properties | |
General Function | Energy production and conversion |
Specific Function | Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. |
Pathways | Not Available |
Reactions | Not Available |
GO Classification | Not Available |
Cellular Location | Not Available |
Gene Properties | |
Chromosome Location | Not Available |
Locus | Not Available |
SNPs | ND2 |
Gene Sequence | Not Available |
Protein Properties | |
Number of Residues | 307 |
Molecular Weight | 34656.0 |
Theoretical pI | 10.59 |
Pfam Domain Function | Not Available |
Signals |
|
Transmembrane Regions |
|
Protein Sequence |
>NADH-ubiquinone oxidoreductase chain 2 IPIMMKNHNPRATEASTKYFLTQSTASMLLMMAVIINLMFSGQWTVMKLFNPMASMLMTM ALAMKLGMAPFHFWVPEVTQGIPLSSGLILLTWQKLAPMSVLYQIFPSINLNLILTLSVL SILIGGWGGLNQTQLRKIMAYSSIAHMGWMTAVLPYNPTMTLLNLIIYIIMTSTMFTMFM ANSTTTTLSLSHTWNKTPIMTVLILATLLSMGGLPPLSGFMPKWMIIQEMTKNNSIILPT FMAITALLNLYFYMRLTYSTTLTMFPSTNNMKMKWQFPLMKKMTFLPTMVVLSTMMLPLT PMLSVLE |
External Links | |
GenBank ID Protein | BAC20229.1 |
UniProtKB/Swiss-Prot ID | Q8HBM0 |
UniProtKB/Swiss-Prot Entry Name | Q8HBM0_BOVIN |
PDB IDs | Not Available |
GenBank Gene ID | AB090958 |
GeneCard ID | ND2 |
GenAtlas ID | Not Available |
HGNC ID | Not Available |
References | |
General References | Not Available |