Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Bovine Metabolome Database.
Identification
BMDB Protein ID BMDBP00356
Secondary Accession Numbers
  • BMDBP03149
Name 6-phosphogluconate dehydrogenase, decarboxylating
Synonyms Not Available
Gene Name PGD
Protein Type Enzyme
Biological Properties
General Function Carbohydrate transport and metabolism
Specific Function Catalyzes the oxidative decarboxylation of 6-phosphogluconate to ribulose 5-phosphate and CO(2), with concomitant reduction of NADP to NADPH.
Pathways
  • Carbohydrate degradation
  • D-ribulose 5-phosphate from D-glucose 6-phosphate (oxidative stage): step 3/3
  • Pentose Phosphate Pathway
Reactions Not Available
GO Classification Not Available
Cellular Location Not Available
Gene Properties
Chromosome Location 16
Locus Not Available
SNPs PGD
Gene Sequence
>1452 bp
ATGGCCCAAGCTGACATTGCCCTGATTGGACTGGCTGTCATGGGCCAGAACTTAATTTTG
AACATGAATGACCATGGCTTTGTGGTCTGTGCTTTTAATAGGACAGTCTCCAAAGTTGAT
GACTTCTTGGCCAACGAGGCGAAGGGCACCAAGGTGCTTGGTGCTCACTCCTTGGAGGAA
ATGGCGTCCAAGCTGAAGAAGCCACGGCGGATCATCCTCCTTGTGAAGGCCGGTCAGGCC
GTTGATGATTTCATTGAGAAACTGGTACCTTTGCTAGACATTGGTGATATCATCATTGAT
GGAGGAAATTCTGAATACAGGGATACCATGAGACGGTGTCGAGACCTCAAGGAGAAGGGC
ATCTTGTTTGTGGGGAGCGGAGTTAGCGGTGGAGAGGACGGGGCCCGATATGGCCCGTCG
CTTATGCCGGGAGGGAACAAGGAGGCCTGGCCCCACATCAAGGCCATCTTCCAAGGCATC
GCCGCCAAAGTGGGGACAGGAGAACCCTGCTGTGACTGGGTGGGGGACGAGGGTGCGGGA
CACTTTGTGAAGATGGTGCACAACGGCATAGAGTACGGGGACATGCAGCTCATCTGTGAG
GCCTACCACCTGATGAGGGACGTCCTGTGCATGGGGCACGCGGAGATGGCCAAGGCCTTT
GAGGAATGGAATAAGACAGAGCTGGACTCATTCCTGATTGAAATCACAGCCAATATTCTT
AAGTTCCAAGATGCTGATGGCAAACACCTGCTGCCAAAGATCCGGGACAGCGCGGGGCAG
AAGGGCACCGGGAAGTGGACCGCCATCTCCGCCCTGGAGTACGGCGTGCCCGTCACCCTC
ATCGGAGAAGCCGTCTTCGCGAGATGCTTATCATCTCTGAAGGATGAGAGGATCCAAGCC
AGCAAAAAGCTGAAGGGGCCTCAGAATGTCCCGTTTGAAGGAGATAAGAAATCATTCCTG
GAGGACATTCGAAAGGCCCTCTATGCTTCCAAGATCATCTCTTACGCTCAGGGCTTCATG
CTGCTAAGACAGGCAGCCACTGAATTTGGCTGGACCCTCAACTATGGCGGCATCGCCCTG
ATGTGGAGGGGGGGCTGCATCATCAGGAGTGTATTCCTGGGAAAGATAAAAGATGCGTTT
GATCGAAACCCAGGACTTCAGAATCTATTGCTGGATGATTTCTTTAAGTCAGCTGTGGAA
AACTGCCAGGACTCCTGGCGGCGGGCCATCAGTACTGGTGTCCAGGCAGGCATTCCCATG
CCCTGCTTCACCACTGCTCTCTCTTTCTACGATGGGTACAGACACGAGATGCTGCCAGCC
AACCTCATCCAGGCTCAGCGCGACTACTTTGGGGCGCATACCTACGAACTCTTGGCCAAG
CCGGGCCAGTTCATCCACACCAACTGGACGGGCCACGGGGGCAGTGTGTCCTCGTCGTCG
TACAACGCCTGA
Protein Properties
Number of Residues 483
Molecular Weight 53077.0
Theoretical pI 7.1
Pfam Domain Function Not Available
Signals
  • None
Transmembrane Regions
  • 5-22
  • 66-87
  • 152-171
  • 202-221
  • 242-261
  • 276-294
  • 323-346
Protein Sequence
>6-phosphogluconate dehydrogenase, decarboxylating
MAQADIALIGLAVMGQNLILNMNDHGFVVCAFNRTVSKVDDFLANEAKGTKVLGAHSLEE
MASKLKKPRRIILLVKAGQAVDDFIEKLVPLLDIGDIIIDGGNSEYRDTMRRCRDLKEKG
ILFVGSGVSGGEDGARYGPSLMPGGNKEAWPHIKAIFQGIAAKVGTGEPCCDWVGDEGAG
HFVKMVHNGIEYGDMQLICEAYHLMRDVLCMGHAEMAKAFEEWNKTELDSFLIEITANIL
KFQDADGKHLLPKIRDSAGQKGTGKWTAISALEYGVPVTLIGEAVFARCLSSLKDERIQA
SKKLKGPQNVPFEGDKKSFLEDIRKALYASKIISYAQGFMLLRQAATEFGWTLNYGGIAL
MWRGGCIIRSVFLGKIKDAFDRNPGLQNLLLDDFFKSAVENCQDSWRRAISTGVQAGIPM
PCFTTALSFYDGYRHEMLPANLIQAQRDYFGAHTYELLAKPGQFIHTNWTGHGGSVSSSS
YNA
GenBank ID Protein AAI02179.2
UniProtKB/Swiss-Prot ID Q3ZCI4
UniProtKB/Swiss-Prot Entry Name Q3ZCI4_BOVIN
PDB IDs
GenBank Gene ID BC102178
GeneCard ID PGD
GenAtlas ID Not Available
HGNC ID Not Available
References
General References Not Available