Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Bovine Metabolome Database.
Identification
BMDB Protein ID BMDBP00414
Secondary Accession Numbers None
Name Methionine synthase
Synonyms Not Available
Gene Name MTR
Protein Type Enzyme
Biological Properties
General Function Amino acid transport and metabolism
Specific Function Catalyzes the transfer of a methyl group from methyl-cobalamin to homocysteine, yielding enzyme-bound cob(I)alamin and methionine. Subsequently, remethylates the cofactor using methyltetrahydrofolate (By similarity).
Pathways
  • Amino-acid biosynthesis
  • Betaine Metabolism
  • L-methionine biosynthesis via de novo pathway
  • L-methionine from L-homocysteine (MetH route): step 1/1
  • Methionine Metabolism
Reactions
Homocysteine + 5-Methyltetrahydrofolic acid → L-Methionine + Tetrahydrofolic acid details
GO Classification Not Available
Cellular Location Not Available
Gene Properties
Chromosome Location 28
Locus Not Available
SNPs MTR
Gene Sequence
>3798 bp
ATGGCCCCCACGCTCCAGGACCTGACGCCATCTGCAGGGATGAAGAAGACCCTGCAAGAT
GAGATTGAAGCTATCCTGCAGGAGAGGATTATGGTGCTTGATGGAGGGATGGGGACCATG
ATCCAGCGGCACAAGCTGAGTGAAGAAGACTTCCGAGGACAAGAATTTAAAGATCATGCC
AGGCCCCTGAAAGGCAACAATGACATTTTAAGTATAACTCAGCCCAATGTCATTTACCAA
ATCCATAAGGAGTACCTCCTAGCTGGGGCAGATATCATTGAAACAAATACTTTCAGCAGC
ACTTCTATTGCCCAAGCTGACTATGGCCTGGAACACTTGGCCTACCGGATGAACATGTGC
TCTGCGGGAGTGGCCAGAAAAGCAGCCGAGGACATCTCTCTCCAGACAGGAATTAAGAGG
TATGTGGCAGGAGCTCTGGGTCCAACTAACAAGACACTCTCTGTGTCGCCATCTGTGGAA
AGACCAGATTACAGGAACATCACATTTGATGAACTTGTTGAAGCATACAAAGAGCAGGCC
AAAGGGCTTCTGGATGGTGGAGTGGATATCTTACTCATTGAAACTATTTTTGATACCGCC
AATGCCAAGGCAGCCTTGTTTGCAGTCCAAAAACTTTTTGAAGAGGAGTATGTTCCCCGG
CCTGTCTTTATTTCAGGGACAATTGTTGATAAAAGTGGGCGGACTCTCTCTGGCCAGACT
GGGGAGGCATTTGTCATCAGCGTGTCTCATGCAGACCCACTCTGCATTGGATTAAATTGT
GCTCTGGGTGCAGCTGAAATGAGACCTTTTATTGAAACAATTGGAAAATGTACAACAGCT
TATGTTCTCTGTTATCCCAATGCAGGTCTTCCCAATACCTTCGGTGACTATGATGAAACT
CCCCACGTGATGGCCATGCATTTAAAGGATTTTGCTGTTGATGGCTTGGTCAACATAGTT
GGCGGATGCTGTGGTACGACACCAGATCATATCAGAGAAATTGCTGAAGCTGTGAAAAAC
TGTAAGCCTAGAGTTCCACCTGCCACTGTTTTCGAAGGGCATATGCTACTGTCTGGTCTA
GAGCCCTTCAGGATTGGACCATACACCAACTTTGTTAACATTGGAGAGCGCTGTAACGTT
GCAGGATCCAGGAGATTTGCTAAGCTCATCATGGCAGGAAATTATGAAGAAGCACTGAGC
GTTGCCAAAATGCAGGTGGAAATGGGAGCCCAGGTGTTGGATATTAACATGGATGATGGC
ATGCTGGATGGTCCAAGTGCAATGACCAGATTCTGCAACTTCATTGCTTCCGAGCCTGAC
ATTGCCAAGGTGCCCTTGTGCATTGACTCTTCCAATTTTGCTGTGATTGAAGCCGGCTTA
AAGTGCTGCCAGGGGAAGTGCATTGTTAATAGCATCAGCTTGAAGGAGGGAGAGGATGAC
TTCTTGGAGAAGGCCAGAAAGATTAAGAAGTTTGGAGCTGCCGTGGTGGTTATGGCTTTT
GATGAAGAAGGACAGGCAACAGAAACAGATCCCAAAATCAGAGTGTGCACCCGGGCCTAC
CATCTCCTTTTGAAAAAACTGGGCTTCAATCCAAATGACATCATCTTTGACCCTAATATC
CTCACCATTGGTACTGGGATGGAAGAACATAACTTGTATGCTGTTAATTTTATCAATGCA
ACAAAAGTCATTAAAGAAACGCTGCCTGGAGCCAAAGTAAGCGGTGGTCTTTCCAACTTG
TCCTTCTCCTTCCGAGGAATGGAAGCCATTCGAGAGGCAATGCATGGGGTTTTCCTGTAC
CATGCGATCAAGTTTGGTATGGACATGGGAATAGTGAATGCTGGAAGCCTTCCTGTATAT
GATGACATCCACAAGGAGCTTCTCCAGCTCTGTGAGGACCTCATCTGGAACAGAGACCCT
GAGGCCACCGAGAAGCTCTTACACTACGCCCAGACTCAGGGCAAAGGAGGGAAGAAAGTC
ATCCAGACTGATGAGTGGAGGAATGGCCCTCTCGAAGAACGCCTTGAGTACGCTCTTGTG
AAGGGCATTGAAAAATATATTATTGAAGATACTGAGGAAGCCAGGTTAAACCAGGAAAAA
TATCCCCGACCTCTGAATATAATTGAAGGGCCGCTGATGAATGGCATGAAAATTGTTGGT
GATCTTTTTGGAGCTGGAAAAATGTTTCTACCTCAGGTTATAAAGTCAGCTCGGGTCATG
AAGAAGGCCGTGGGTCACCTTATTCCCTTCATGGAAAAAGAGAGAGAAGAAACCAAAGTG
CTTACTGGCAAAATAGAAGATGAGGACCCTTACCAAGGCACCATCGTGCTGGCTACTGTT
AAAGGTGACGTACACGACATAGGCAAGAACATAGTTGGAGTGGTTCTTGGCTGCAATAAT
TTCAGAGTTATTGATTTAGGAGTCATGACTCCATGTGACAAGATACTGAAGGCTGCTCTA
GACCACAAAGCAGATATAATTGGCCTGTCAGGACTCATCACTCCTTCCCTGGATGAAATG
ATTTTTGTCGCTAAGGAAATGGAGAGACTAGCTATAAAGATCCCATTGTTGATCGGAGGA
GCTACCACTTCCAGAACCCACACAGCAGTTAAAATAGCCCCAAGATACAGTGCGCCCGTG
ATCCACGTCCTGGATGCATCCAAGAGCGTGGTGGTGTGTTCTCAACTGTTAGATGAGAAT
CTAAAAGATGAGTACTTTGAGGAGATCCTGGAAGAATATGAAGATATTAGACAGGACCAT
TATGAATCTCTCAAGGAGAGAAGATACTTAACCTTAAGGCAAGCTAGAGAAAATGGTTTC
CATATTGACTGGCTGTCAGAGCCTCCTCCAGTGAAGCCCACGTTCCTCGGGACTCGGGTC
TTTGAAGACTACGACCTGCAGAAGCTGGTGGACTACATTGATTGGAAGCCTTTCTTCGAC
GTCTGGCAGCTCCGGGGCAAATACCCGAACCGAGGCTTTCCCAAGATATTTGACGACAAA
ACTGTAGGTGAAGAGGCCAAAAAGGTCTATGATGATGCCCAAAATATGCTGCAGGCACTG
ATCAGTCAGAAGAAGCTCCAGGCCAGGGGTGTGGTTGGGTTCTGGCCAGCACAGAGCATT
CAGGATGATATCCACCTGTACGCGGAAGGCGCAGTGCCACAGGCCTCGGAGCCCATAGCC
ACCTTCTACGGGCTCAGGCAGCAGGCCGAGAAGGACTCTGCCAGCTCGGACCCCTACCTC
TGCCTCTCGGACTTCATCGCCCCTCTGCACTCAGGTATCCCCGACTACCTGGGCCTGTTC
GCCGTTGCCTGCTTTGGGGTGGAGGAGCTGAGCAAGGCCTACGAGGAGGAGTGTGATGAC
TACAGCAGCATCATGGTCAAGGCGCTGGGGGACCGGCTGGCCGAGGCCTTCGCTGAGGAG
CTGCACGAGCGGGCCCGCAGGGAGCTGTGGGGTTACTGTAGTGGTGAGCAGCTGGCTGTG
GCTGACCTGCGGAGACTGCGCTACGAGGGCATCCGGCCGGCGCCCGGCTATCCCAGCCAG
CCTGACCACACTGAGAAGCTGACCGTGTGGAGGCTGGCGGACGTGGAGCAGCGCACAGGC
ATTAGGTTAACAGAATCGCTGGCCATGGCACCTGCTTCAGCAGTATCTGGCCTTTACTTC
TCCAACTTGAAGTCCAAGTATTTTGCCGTGGGGAAAATTTCCAAGGATCAGATTGAGGAT
TATGCTTCGAGGAAGAACATGTCTGTGGCCGAGGTTGAGAAATGGCTTGGACCCATTTTG
GGATATGATACAGACTAA
Protein Properties
Number of Residues 1265
Molecular Weight 140478.0
Theoretical pI 4.99
Pfam Domain Function Not Available
Signals
  • None
Transmembrane Regions Not Available
Protein Sequence
>Methionine synthase
MAPTLQDLTPSAGMKKTLQDEIEAILQERIMVLDGGMGTMIQRHKLSEEDFRGQEFKDHA
RPLKGNNDILSITQPNVIYQIHKEYLLAGADIIETNTFSSTSIAQADYGLEHLAYRMNMC
SAGVARKAAEDISLQTGIKRYVAGALGPTNKTLSVSPSVERPDYRNITFDELVEAYKEQA
KGLLDGGVDILLIETIFDTANAKAALFAVQKLFEEEYVPRPVFISGTIVDKSGRTLSGQT
GEAFVISVSHADPLCIGLNCALGAAEMRPFIETIGKCTTAYVLCYPNAGLPNTFGDYDET
PHVMAMHLKDFAVDGLVNIVGGCCGTTPDHIREIAEAVKNCKPRVPPATVFEGHMLLSGL
EPFRIGPYTNFVNIGERCNVAGSRRFAKLIMAGNYEEALSVAKMQVEMGAQVLDINMDDG
MLDGPSAMTRFCNFIASEPDIAKVPLCIDSSNFAVIEAGLKCCQGKCIVNSISLKEGEDD
FLEKARKIKKFGAAVVVMAFDEEGQATETDPKIRVCTRAYHLLLKKLGFNPNDIIFDPNI
LTIGTGMEEHNLYAVNFINATKVIKETLPGAKVSGGLSNLSFSFRGMEAIREAMHGVFLY
HAIKFGMDMGIVNAGSLPVYDDIHKELLQLCEDLIWNRDPEATEKLLHYAQTQGKGGKKV
IQTDEWRNGPLEERLEYALVKGIEKYIIEDTEEARLNQEKYPRPLNIIEGPLMNGMKIVG
DLFGAGKMFLPQVIKSARVMKKAVGHLIPFMEKEREETKVLTGKIEDEDPYQGTIVLATV
KGDVHDIGKNIVGVVLGCNNFRVIDLGVMTPCDKILKAALDHKADIIGLSGLITPSLDEM
IFVAKEMERLAIKIPLLIGGATTSRTHTAVKIAPRYSAPVIHVLDASKSVVVCSQLLDEN
LKDEYFEEILEEYEDIRQDHYESLKERRYLTLRQARENGFHIDWLSEPPPVKPTFLGTRV
FEDYDLQKLVDYIDWKPFFDVWQLRGKYPNRGFPKIFDDKTVGEEAKKVYDDAQNMLQAL
ISQKKLQARGVVGFWPAQSIQDDIHLYAEGAVPQASEPIATFYGLRQQAEKDSASSDPYL
CLSDFIAPLHSGIPDYLGLFAVACFGVEELSKAYEEECDDYSSIMVKALGDRLAEAFAEE
LHERARRELWGYCSGEQLAVADLRRLRYEGIRPAPGYPSQPDHTEKLTVWRLADVEQRTG
IRLTESLAMAPASAVSGLYFSNLKSKYFAVGKISKDQIEDYASRKNMSVAEVEKWLGPIL
GYDTD
GenBank ID Protein AAY86762.1
UniProtKB/Swiss-Prot ID Q4JIJ3
UniProtKB/Swiss-Prot Entry Name METH_BOVIN
PDB IDs Not Available
GenBank Gene ID DQ084519
GeneCard ID MTR
GenAtlas ID Not Available
HGNC ID Not Available
References
General References Not Available