Showing Protein U8 snoRNA-decapping enzyme (BMDBP00444)
Identification | |
---|---|
BMDB Protein ID | BMDBP00444 |
Secondary Accession Numbers | None |
Name | U8 snoRNA-decapping enzyme |
Synonyms | Not Available |
Gene Name | NUDT16 |
Protein Type | Enzyme |
Biological Properties | |
General Function | Involved in hydrolase activity |
Specific Function | RNA-binding and decapping enzyme that catalyzes the cleavage of the cap structure of snoRNAs and mRNAs in a metal-dependent manner. Part of the U8 snoRNP complex that is required for the accumulation of mature 5.8S and 28S rRNA. Has diphosphatase activity and removes m7G and/or m227G caps from U8 snoRNA and leaves a 5'monophosphate on the RNA. Catalyzes also the cleavage of the cap structure on mRNAs. Does not hydrolyze cap analog structures like 7-methylguanosine nucleoside triphosphate (m7GpppG). Also hydrolysis m7G- and m227G U3-capped RNAs but with less efficiencies. Has broad substrate specificity with manganese or cobalt as cofactor and can act on various RNA species. Binds to the U8 snoRNA; metal is not required for RNA-binding. May play a role in the regulation of snoRNAs and mRNAs degradation. Acts also as a phosphatase; hydrolyzes the non-canonical purine nucleotides inosine diphosphate (IDP) and deoxyinosine diphosphate (dITP) as well as guanosine diphosphate (GDP), deoxyguanosine diphosphate (dGDP), xanthine diphosphate (XDP), inosine triphosphate (ITP) and deoxyinosine triphosphate (ITP) to their respective monophosphate derivatives and does not distinguish between the deoxy- and ribose forms. The order of activity with different substrates is IDP > dIDP >> GDP = dGDP > XDP = ITP = dITP. Binds strongly to GTP, ITP and XTP. Participates in the hydrolysis of dIDP/IDP and probably excludes non-canonical purines from RNA and DNA precursor pools, thus preventing their incorporation into RNA and DNA and avoiding chromosomal lesions. |
Pathways | Not Available |
Reactions | Not Available |
GO Classification | Not Available |
Cellular Location | Not Available |
Gene Properties | |
Chromosome Location | 1 |
Locus | Not Available |
SNPs | NUDT16 |
Gene Sequence |
>588 bp ATGGCCGGTATGCGTAGGCTTGAGCTGTCGGAAGCCCTGCATCTGGGGCCGGGCTGGCGG CACGCGTGCCACGCGCTGCTCTACGCACCGGACCCAGGGCTGCTCTTTGGCCGCATTCCG CTACGCTACGCCGTGCTGATGCAGATGCGCTTTGATGGGCGCCTGGGCTTCCCTGGCGGC TTCGTGGACTTGCGCGACGGCAGCTTGGAGGACGGGCTGAATCGCGAGTTGGGCGAGGAG CTGGGCGAGGCTGCGGGCGCCTTTCGTGTGGAGCGCGCTGACTACCGCAGCTCCCACGCT GGGTCCCGGCCGCGCGTGGTGGCGCACTTCTACACTAAGCTCCTGACCCTGGAGCAGCTG ACTGCGGTGGAGATGGGCGCGCCTCGCGCCCGAGACCACGGGCTGGAGGTGCTGGGCCTG GTGCGGGTGCCCCTGTATACCCTGCGGGATGGTGTGGGAGGCCTGCCTGCCTTCCTGGAG AATACCTTTATTGGAAATGCACGGGAACAGCTGCTGGAAGCCGTCCAGAACCTGGGACTG CTGGAACCTGGCTCTTTTGCACGCCTTAAGATTTCAACTCCTCCCTAG |
Protein Properties | |
Number of Residues | 195 |
Molecular Weight | 21399.0 |
Theoretical pI | 7.17 |
Pfam Domain Function | Not Available |
Signals |
|
Transmembrane Regions | Not Available |
Protein Sequence |
>U8 snoRNA-decapping enzyme MAGMRRLELSEALHLGPGWRHACHALLYAPDPGLLFGRIPLRYAVLMQMRFDGRLGFPGG FVDLRDGSLEDGLNRELGEELGEAAGAFRVERADYRSSHAGSRPRVVAHFYTKLLTLEQL TAVEMGAPRARDHGLEVLGLVRVPLYTLRDGVGGLPAFLENTFIGNAREQLLEAVQNLGL LEPGSFARLKISTPP |
External Links | |
GenBank ID Protein | AAI26815.1 |
UniProtKB/Swiss-Prot ID | A1A4Q9 |
UniProtKB/Swiss-Prot Entry Name | NUD16_BOVIN |
PDB IDs | Not Available |
GenBank Gene ID | BC126814 |
GeneCard ID | NUDT16 |
GenAtlas ID | Not Available |
HGNC ID | Not Available |
References | |
General References | Not Available |