Showing Protein M1-type pyruvate kinase (BMDBP00449)
Identification | |
---|---|
BMDB Protein ID | BMDBP00449 |
Secondary Accession Numbers | None |
Name | M1-type pyruvate kinase |
Synonyms | Not Available |
Gene Name | PKM |
Protein Type | Enzyme |
Biological Properties | |
General Function | Carbohydrate transport and metabolism |
Specific Function | Not Available |
Pathways | Not Available |
Reactions | Not Available |
GO Classification | Not Available |
Cellular Location | Not Available |
Gene Properties | |
Chromosome Location | 10 |
Locus | Not Available |
SNPs | PKM |
Gene Sequence | Not Available |
Protein Properties | |
Number of Residues | 149 |
Molecular Weight | 16527.0 |
Theoretical pI | 9.23 |
Pfam Domain Function | Not Available |
Signals |
|
Transmembrane Regions | Not Available |
Protein Sequence |
>Pyruvate kinase CIMLSGETAKGDYPLEAVRMQHLIAREAEAAMFHRKLFEELARASSHSTDLMEAMAMGSV EASYKCLAAALIVLTESGRSAHQVARYRPRAPIIAVTRNHQTARQAHLYRGIFPVVCKDP VQEAWAEDVDLRVNLAMNVGKARGFFKKG |
External Links | |
GenBank ID Protein | BAG50394.1 |
UniProtKB/Swiss-Prot ID | B3IVN4 |
UniProtKB/Swiss-Prot Entry Name | B3IVN4_BOVIN |
PDB IDs | |
GenBank Gene ID | AB355747 |
GeneCard ID | PKM |
GenAtlas ID | Not Available |
HGNC ID | Not Available |
References | |
General References | Not Available |