Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Bovine Metabolome Database.
Identification
BMDB Protein ID BMDBP00486
Secondary Accession Numbers None
Name Nucleoside diphosphate kinase 7
Synonyms Not Available
Gene Name NME7
Protein Type Enzyme
Biological Properties
General Function Nucleotide transport and metabolism
Specific Function Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate (By similarity).
Pathways
  • Purine Metabolism
  • Pyrimidine Metabolism
Reactions
Adenosine triphosphate + Guanosine diphosphate → ADP + Guanosine triphosphate details
Adenosine triphosphate + dGDP → ADP + dGTP details
Adenosine triphosphate + IDP → ADP + Inosine triphosphate details
Uridine triphosphate + ADP → Uridine 5'-diphosphate + Adenosine triphosphate details
Cytidine triphosphate + ADP → CDP + Adenosine triphosphate details
dCDP + Adenosine triphosphate → dCTP + ADP details
dTDP + Adenosine triphosphate → Thymidine 5'-triphosphate + ADP details
Deoxyuridine triphosphate + ADP → dUDP + Adenosine triphosphate details
GO Classification Not Available
Cellular Location Not Available
Gene Properties
Chromosome Location 16
Locus Not Available
SNPs NME7
Gene Sequence
>1134 bp
ATGAATCATAGTGAGAGGTTCGTTTTCATCGCAGAGTGGTTTGATCCAAATGCTTCACTA
TTTCGACGTTATGAACTTTTATTTTACCCCGGGGATGGATCTGTTGAAATGCATGATGTA
AAGAATCATCGCACCTTTTTAAAGCGGACAAAATATGAAGATCTTCACCTGGAAGATTTA
TTTATAGGCAACAAAGTGAACATCTTTTCTCGACAACTGGTGCTGCTTGACTATGGAGAT
CAATACACAGCTCGTCAACTGGGCAGTAAGAAAGAAAAAACATTAGCCCTGATTAAACCA
GATGCAGTATCAAAAGCTGGAGAAATAATTGAAATAATAAACAAAGCTGGATTTACTCTA
ACCAAACTCAAAATGATGACGCTATCAAGGAAAGAAGCAACAGATTTTCATATAGACCAT
CAGTCAAGGCCCTTTTTAAATGAGCTGATCCAGTTTATTACAAGTGGACCTATAATTGCC
ATGGAGATTTTACGAGATGATGCTGTATGTGAATGGAAGAGACTTCTTGGACCTGCGAAC
TCTGGACTGGCACGTACAGATGCTCCTGAAAGCATTAGAGCCCTCTTTGGAACAGATGGC
ATAAAGAATGCAGCTCATGGCCCCGATTCTTTTGCTTGTGCTGCCAGAGAAATGGAGTTA
TTTTTTCCTTCAAGTGGAGTGTGTGGGCCAGCAAACACTGCTAAATTTACTAATTGTACT
ACTTGTTGCATTGTTAAGCCCCATGCTGTCAGCGAAGGACTTCTGGGAAAGATCCTGATG
ACTATCCGAGATGCAGGTTTTGAAATCTCAGCTATGCAGATGTTTAACATGGATCGGATT
AATGTTGAAGAGTTTTATGAAGTTTATAAAGGAGTAGTGTCTGAGTATAATGAAATGGTG
ACAGAAATGTATTCTGGGCCTTGTGTAGCAATGGAGATTCAACAAACTAATCCTACAATG
ACATTTCGAGAATTCTGTGGACCTGCTGATCCTGAAATTGCCCGACATTTACGCCCTGGA
ACCCTCCGAGCAATCTTTGGTAAAACTAAGATCCAGAATGCTGTTCACTGTACGGATCTG
CCAGAAGATGGTCTATTAGAGGTTCAGTATTTCTTCAAAATCTTGGATAACTAG
Protein Properties
Number of Residues 377
Molecular Weight 42599.0
Theoretical pI 6.02
Pfam Domain Function Not Available
Signals
  • None
Transmembrane Regions Not Available
Protein Sequence
>Nucleoside diphosphate kinase 7
MNHSERFVFIAEWFDPNASLFRRYELLFYPGDGSVEMHDVKNHRTFLKRTKYEDLHLEDL
FIGNKVNIFSRQLVLLDYGDQYTARQLGSKKEKTLALIKPDAVSKAGEIIEIINKAGFTL
TKLKMMTLSRKEATDFHIDHQSRPFLNELIQFITSGPIIAMEILRDDAVCEWKRLLGPAN
SGLARTDAPESIRALFGTDGIKNAAHGPDSFACAAREMELFFPSSGVCGPANTAKFTNCT
TCCIVKPHAVSEGLLGKILMTIRDAGFEISAMQMFNMDRINVEEFYEVYKGVVSEYNEMV
TEMYSGPCVAMEIQQTNPTMTFREFCGPADPEIARHLRPGTLRAIFGKTKIQNAVHCTDL
PEDGLLEVQYFFKILDN
GenBank ID Protein AAX08797.1
UniProtKB/Swiss-Prot ID Q5E9Y9
UniProtKB/Swiss-Prot Entry Name NDK7_BOVIN
PDB IDs Not Available
GenBank Gene ID BT020780
GeneCard ID NME7
GenAtlas ID Not Available
HGNC ID Not Available
References
General References Not Available