You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Bovine Metabolome Database.
Showing Protein Tubulin--tyrosine ligase (BMDBP00505)
Identification | |
---|---|
BMDB Protein ID | BMDBP00505 |
Secondary Accession Numbers | None |
Name | Tubulin--tyrosine ligase |
Synonyms | Not Available |
Gene Name | TTL |
Protein Type | Enzyme |
Biological Properties | |
General Function | Involved in ATP binding |
Specific Function | Catalyzes the post-translational addition of a tyrosine to the C-terminal end of detyrosinated alpha-tubulin. |
Pathways | Not Available |
Reactions | Not Available |
GO Classification | Not Available |
Cellular Location | Not Available |
Gene Properties | |
Chromosome Location | 11 |
Locus | Not Available |
SNPs | TTL |
Gene Sequence | Not Available |
Protein Properties | |
Number of Residues | 377 |
Molecular Weight | 43270.0 |
Theoretical pI | 6.79 |
Pfam Domain Function | Not Available |
Signals |
|
Transmembrane Regions |
|
Protein Sequence |
>Tubulin--tyrosine ligase MYTFVVRDENSSVYAEVSRLLLATGHWKRLRRDNPRFNLMLGERNRLPFGRLGHEPGLMQ LVNYYRGADKLCRKASLVKLIKTSPELAESCTWFPESYVIYPTNLKTPVAPAQDGIHPPL HSSRTDEREFFLASYNRKKEEGEGNVWIAKSSAGAKGEGILISSDATELLDFIDNQGQVH VIQKYLERPLLLEPGHRKFDIRSWVLVDHQFNIYLYREGVLRTASEPYHMDNFQDKTCHL TNHCIQKEYSKNYGKYEEGNEMFFEAFNRYLTSALNITLESSILLQIKHIIRSCLMSVEP AISTKHLPYQSFQLFGFDFMVDEELKVWLIEVNGAPACAQKLYAELCQGIVDIAIASVFP PPDAEQQPPQPATFIKL |
External Links | |
GenBank ID Protein | Not Available |
UniProtKB/Swiss-Prot ID | P38584 |
UniProtKB/Swiss-Prot Entry Name | TTL_BOVIN |
PDB IDs | |
GenBank Gene ID | Not Available |
GeneCard ID | TTL |
GenAtlas ID | Not Available |
HGNC ID | Not Available |
References | |
General References | Not Available |