Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Bovine Metabolome Database.
Identification
BMDB Protein ID BMDBP00536
Secondary Accession Numbers
  • BMDBP03154
Name Thymidylate synthase
Synonyms Not Available
Gene Name TYMS
Protein Type Enzyme
Biological Properties
General Function Nucleotide transport and metabolism
Specific Function Contributes to the de novo mitochondrial thymidylate biosynthesis pathway.
Pathways
  • DTTP biosynthesis
  • Pyrimidine Metabolism
Reactions
dUMP + 5,10-Methylene-THF → 5-Thymidylic acid + Dihydrofolic acid details
5-Thymidylic acid + Adenosine triphosphate → dTDP + ADP details
dUMP + Adenosine triphosphate → dUDP + ADP details
GO Classification Not Available
Cellular Location Not Available
Gene Properties
Chromosome Location 24
Locus Not Available
SNPs TYMS
Gene Sequence
>1065 bp
ATGCCAGCGGCCGGCTCCGAGCCGTCGCGCCCGCCGTCGCCGCCCGGCGTGCAGGAGCAG
AGCGCCGAGCCGCGGCCGCCGCCGCCGCCGCACGGGGAGCTGCAGTACCTGGGGCAGATA
GAACACATCCTCCGCTGCGGCTTCCGGAGGGATGACCGCACCGGCACTGGCACCCTGTCG
GTGTTCGGGATGCAGGCGCGGTACAACTTGAGAGATGAATTTCCTCTGCTGACAACCAAA
CGTGTTTTCTGGAAAGGTGTTTTGGAGGAGTTGCTGTGGTTTATCAAGGGATCCACCAAC
GCTAAGGAACTCTCTTCCAAGGGAGTGAAAATTTGGGATGCCAATGGGTCCCGAGACTTC
TTGGATGGCCTGGGCTTCTCCGACAGAGCTGAAGGGGATTTAGGCCCAGTTTATGGCTTC
CAGTGGAGGCATTTTGGGGCTGAATACAAAGATATGGATTCAGAGTATTCAGGTCAAGGA
GTAGATCAACTGCAAAAAGTGATCGACACAATCAAAACCAACCCTAACGACAGAAGAATC
ATCCTGTGTGCTTGGAATCCAAAAGATCTGCCTCTCATGGCCCTCCCCCCATGCCACGCC
CTCTGCCAGTTCTACGTGGTGAATGGGGAGTTGTCCTGCCAGTTGTACCAGCGGTCGGGG
GACATGGGCCTGGGTGTGCCCTTCAACATTGCCAGCTACGCCCTGCTCACCTACATGATC
GCACACATCACGGACCTGAAGCCAGGTGACTTCGTGCACACTCTGGGAGATGCACACATT
TACCTGAATCACATCGAGCCACTGAAAACTCAGGCTCTGATGGAGCTAAGAGGACAGTCT
TCCAGGTCTCTGGATGGTGATGGACAGGCAGGGACCAGCAGATGGGCCCCAGTGGCCACA
GACACTGAACGTGACAGGTGCTGTGAGCTGCAGCGAGAACCAAGGCCTTTCCCCAAGCTC
AAAATCCTTCGAAAAGTTGAGACAATCGATGACTTCCAGGCCGAAGACTTTCAGATTGAA
GGCTACAATCCTAATCCGACTATTAAAATGGAAATGGCTGTCTAG
Protein Properties
Number of Residues 354
Molecular Weight 39785.0
Theoretical pI 5.66
Pfam Domain Function Not Available
Signals
  • None
Transmembrane Regions Not Available
Protein Sequence
>Thymidylate synthase
MPAAGSEPSRPPSPPGVQEQSAEPRPPPPPHGELQYLGQIEHILRCGFRRDDRTGTGTLS
VFGMQARYNLRDEFPLLTTKRVFWKGVLEELLWFIKGSTNAKELSSKGVKIWDANGSRDF
LDGLGFSDRAEGDLGPVYGFQWRHFGAEYKDMDSEYSGQGVDQLQKVIDTIKTNPNDRRI
ILCAWNPKDLPLMALPPCHALCQFYVVNGELSCQLYQRSGDMGLGVPFNIASYALLTYMI
AHITDLKPGDFVHTLGDAHIYLNHIEPLKTQALMELRGQSSRSLDGDGQAGTSRWAPVAT
DTERDRCCELQREPRPFPKLKILRKVETIDDFQAEDFQIEGYNPNPTIKMEMAV
GenBank ID Protein AAI11140.1
UniProtKB/Swiss-Prot ID Q2TA32
UniProtKB/Swiss-Prot Entry Name TYSY_BOVIN
PDB IDs Not Available
GenBank Gene ID BC111139
GeneCard ID TYMS
GenAtlas ID Not Available
HGNC ID Not Available
References
General References Not Available