Showing Protein Iodothyronine deiodinase (BMDBP00545)
| Identification | |
|---|---|
| BMDB Protein ID | BMDBP00545 |
| Secondary Accession Numbers | None |
| Name | Iodothyronine deiodinase |
| Synonyms | Not Available |
| Gene Name | Not Available |
| Protein Type | Enzyme |
| Biological Properties | |
| General Function | Involved in selenium binding |
| Specific Function | Responsible for the deiodination of T4 (3,5,3',5'-tetraiodothyronine). |
| Pathways | Not Available |
| Reactions | Not Available |
| GO Classification | Not Available |
| Cellular Location | Not Available |
| Gene Properties | |
| Chromosome Location | 3 |
| Locus | Not Available |
| SNPs | Not Available |
| Gene Sequence | Not Available |
| Protein Properties | |
| Number of Residues | 97 |
| Molecular Weight | 11173.0 |
| Theoretical pI | 6.24 |
| Pfam Domain Function | Not Available |
| Signals |
|
| Transmembrane Regions | Not Available |
| Protein Sequence |
>Iodothyronine deiodinase SFIFKFDQFKRLIEDFGSVADFLIIYIEEAHASDGWAFKNNVDIKNHRNLQDRLRAAHLL LDRSPPCPVVVDTMTNQSSSCYAALPERLYVLQEGRV |
| External Links | |
| GenBank ID Protein | AAK15277.1 |
| UniProtKB/Swiss-Prot ID | Q9BDR5 |
| UniProtKB/Swiss-Prot Entry Name | Q9BDR5_BOVIN |
| PDB IDs | Not Available |
| GenBank Gene ID | AF318504 |
| GeneCard ID | Not Available |
| GenAtlas ID | Not Available |
| HGNC ID | Not Available |
| References | |
| General References | Not Available |