You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Bovine Metabolome Database.
Showing Protein Inducible nitric oxid synthase (BMDBP00557)
Identification | |
---|---|
BMDB Protein ID | BMDBP00557 |
Secondary Accession Numbers | None |
Name | Inducible nitric oxid synthase |
Synonyms | Not Available |
Gene Name | iNOS |
Protein Type | Enzyme |
Biological Properties | |
General Function | Involved in arginine binding |
Specific Function | Not Available |
Pathways | Not Available |
Reactions | Not Available |
GO Classification | Not Available |
Cellular Location | Not Available |
Gene Properties | |
Chromosome Location | 19 |
Locus | Not Available |
SNPs | iNOS |
Gene Sequence | Not Available |
Protein Properties | |
Number of Residues | 105 |
Molecular Weight | 12093.0 |
Theoretical pI | 9.28 |
Pfam Domain Function | Not Available |
Signals |
|
Transmembrane Regions | Not Available |
Protein Sequence |
>Inducible nitric oxid synthase TYQLTGDELIFATKQAWRNAPRCIGRIQWSNLQVFDARSCSTAQEMFEHICRHVRYATNN GNIRSAITVFPQRSDGKHDFRVWNAQLIRYAGYQMPDGSIRGDPA |
External Links | |
GenBank ID Protein | CAG27866.1 |
UniProtKB/Swiss-Prot ID | Q6ZXD5 |
UniProtKB/Swiss-Prot Entry Name | Q6ZXD5_BOVIN |
PDB IDs | |
GenBank Gene ID | AJ699400 |
GeneCard ID | iNOS |
GenAtlas ID | Not Available |
HGNC ID | Not Available |
References | |
General References | Not Available |