Showing Protein Aspartoacylase (BMDBP00562)
| Identification | |||
|---|---|---|---|
| BMDB Protein ID | BMDBP00562 | ||
| Secondary Accession Numbers | None | ||
| Name | Aspartoacylase | ||
| Synonyms | Not Available | ||
| Gene Name | ASPA | ||
| Protein Type | Enzyme | ||
| Biological Properties | |||
| General Function | Amino acid transport and metabolism | ||
| Specific Function | Catalyzes the deacetylation of N-acetylaspartic acid (NAA) to produce acetate and L-aspartate. NAA occurs in high concentration in brain and its hydrolysis NAA plays a significant part in the maintenance of intact white matter (By similarity). | ||
| Pathways |
|
||
| Reactions |
|
||
| GO Classification | Not Available | ||
| Cellular Location | Not Available | ||
| Gene Properties | |||
| Chromosome Location | 19 | ||
| Locus | Not Available | ||
| SNPs | ASPA | ||
| Gene Sequence | Not Available | ||
| Protein Properties | |||
| Number of Residues | 313 | ||
| Molecular Weight | 35738.0 | ||
| Theoretical pI | 6.65 | ||
| Pfam Domain Function | Not Available | ||
| Signals |
|
||
| Transmembrane Regions | Not Available | ||
| Protein Sequence |
>Aspartoacylase MTSCHVAEDPIKKVAIFGGTHGNELTGVFLVKHWLENSTEIQRTGLEVKPFITNPRAVKK CTRYIDCDLNRVFDPENLGKKKSEDLPYEVRRAQEINHLFGPKDSEDSYDIIFDLHNTTS NMGCTLILEDSRNDFLIQMFHYIKTSLAPLPCYVYLIEHPSLKYATTRSIAKYPVGIEVG PQPQGVLRADILDQMRKMIQHALDFIHNFNEGKEFPPCAIEVYKIMRKVDYPRNESGEIS AIIHPKLQDQDWKPLHPEDPVFLTLDGKTIPLGGDQTVYPVFVNEAAYYEKKEAFAKTTK LTLNANSIRSSLH |
||
| External Links | |||
| GenBank ID Protein | AAD14980.1 | ||
| UniProtKB/Swiss-Prot ID | P46446 | ||
| UniProtKB/Swiss-Prot Entry Name | ACY2_BOVIN | ||
| PDB IDs | Not Available | ||
| GenBank Gene ID | S74726 | ||
| GeneCard ID | ASPA | ||
| GenAtlas ID | Not Available | ||
| HGNC ID | Not Available | ||
| References | |||
| General References | Not Available | ||