Showing Protein Single-stranded DNA cytosine deaminase (BMDBP00580)
| Identification | |
|---|---|
| BMDB Protein ID | BMDBP00580 |
| Secondary Accession Numbers | None |
| Name | Single-stranded DNA cytosine deaminase |
| Synonyms | Not Available |
| Gene Name | AICDA |
| Protein Type | Enzyme |
| Biological Properties | |
| General Function | Involved in cytidine deaminase activity |
| Specific Function | Single-stranded DNA-specific cytidine deaminase. Involved in somatic hypermutation (SHM), gene conversion, and class-switch recombination (CSR) in B-lymphocytes by deaminating C to U during transcription of Ig-variable (V) and Ig-switch (S) region DNA. Required for several crucial steps of B-cell terminal differentiation necessary for efficient antibody responses. May also play a role in the epigenetic regulation of gene expression by participating in DNA demethylation. |
| Pathways | Not Available |
| Reactions | Not Available |
| GO Classification | Not Available |
| Cellular Location | Not Available |
| Gene Properties | |
| Chromosome Location | 5 |
| Locus | Not Available |
| SNPs | AICDA |
| Gene Sequence | Not Available |
| Protein Properties | |
| Number of Residues | 199 |
| Molecular Weight | 24052.0 |
| Theoretical pI | 9.65 |
| Pfam Domain Function | Not Available |
| Signals |
|
| Transmembrane Regions | Not Available |
| Protein Sequence |
>Activation-induced cytidine deaminase MDSLLKKQRQFLYQFKNVRWAKGRHETYLCYVVKRRDSPTSFSLDFGHLRNKAGCHVELL FLRYISDWDLDPGRCYRVTWFTSWSPCYDCARHVADFLRGYPNLSLRIFTARLYFCDKER KAEPEGLRRLHRAGVQIAIMTFKDYFYCWNTFVENHERTFKAWEGLHENSVRLSRQLRRI LLPLYEVDDLRDAFRTLGL |
| External Links | |
| GenBank ID Protein | ABC46408.1 |
| UniProtKB/Swiss-Prot ID | Q2PT36 |
| UniProtKB/Swiss-Prot Entry Name | AICDA_BOVIN |
| PDB IDs | Not Available |
| GenBank Gene ID | DQ303466 |
| GeneCard ID | AICDA |
| GenAtlas ID | Not Available |
| HGNC ID | Not Available |
| References | |
| General References | Not Available |