Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Bovine Metabolome Database.
Identification
BMDB Protein ID BMDBP00584
Secondary Accession Numbers
  • BMDBP03151
Name GTP:AMP phosphotransferase AK3, mitochondrial
Synonyms Not Available
Gene Name AK3
Protein Type Enzyme
Biological Properties
General Function Nucleotide transport and metabolism
Specific Function Involved in maintaining the homeostasis of cellular nucleotides by catalyzing the interconversion of nucleoside phosphates. Has GTP:AMP phosphotransferase and ITP:AMP phosphotransferase activities.
Pathways Not Available
Reactions
Uridine 5'-diphosphate + ADP → Uridine triphosphate + 3'-AMP details
GO Classification Not Available
Cellular Location Not Available
Gene Properties
Chromosome Location 8
Locus Not Available
SNPs AK3
Gene Sequence
>684 bp
GCCCAGCCTCTTTCTGCAGCTATGGGGGCGTCTGCGCGGCTACTGCGCGCAGCGATCATG
GGGGCGCCGGGCTCTGGCAAAGGCACCGTGTCCTCGCGCATCACCAAACACTTCGAGCTG
AAGCACCTCTCCAGCGGGGACCTGCTCAGAGATAATATGCTTCGGGGCACAGAAATTGGT
GTTTTAGCCAAGACTTTCATTGACCAAGGGAAGCTCATCCCAGACGATGTCATGACTCGG
TTGGTCCTTCATGAGCTGAAAAATCTCACCCAATATAACTGGCTGTTGGATGGCTTTCCA
AGGACACTTCCGCAGGCAGAAGCCCTGGATAGAGCCTATCAGATAGACACAGTGATTAAC
CTGAACGTGCCCTTTGAGGTCATCAAGCAACGCCTTACTGCTCGCTGGATCCATCCAGGC
AGCGGCCGTGTCTACAACATCGAGTTCAACCCTCCCAAAACCATGGGAATTGATGATCTG
ACTGGGGAGCCTCTTGTTCAGCGTGAGGATGATAGACCAGAGACAGTTGTCAAGAGACTG
AAAGCTTATGAAGCCCAAACAGAGCCTGTCCTGGAGTACTACAGGAAAAAAGGGGTGTTG
GAAACATTCTCTGGAACAGAAACCAACAAGATCTGGCCACATGTATATGCTTTCCTACAA
ACAAAACTTCCACAAAGAAGCCAG
Protein Properties
Number of Residues 227
Molecular Weight 25671.0
Theoretical pI 9.51
Pfam Domain Function Not Available
Signals
  • None
Transmembrane Regions Not Available
Protein Sequence
>GTP:AMP phosphotransferase mitochondrial
MGASARLLRAAIMGAPGSGKGTVSSRITKHFELKHLSSGDLLRDNMLRGTEIGVLAKTFI
DQGKLIPDDVMTRLVLHELKNLTQYNWLLDGFPRTLPQAEALDRAYQIDTVINLNVPFEV
IKQRLTARWIHPGSGRVYNIEFNPPKTMGIDDLTGEPLVQREDDRPETVVKRLKAYEAQT
EPVLEYYRKKGVLETFSGTETNKIWPHVYAFLQTKLPQRSQETSVTP
GenBank ID Protein AAA30705.1
UniProtKB/Swiss-Prot ID P08760
UniProtKB/Swiss-Prot Entry Name KAD3_BOVIN
PDB IDs
GenBank Gene ID M25757
GeneCard ID AK3
GenAtlas ID Not Available
HGNC ID Not Available
References
General References Not Available