Showing Protein Superoxide dismutase [Mn], mitochondrial (BMDBP00586)
Identification | |
---|---|
BMDB Protein ID | BMDBP00586 |
Secondary Accession Numbers | None |
Name | Superoxide dismutase [Mn], mitochondrial |
Synonyms | Not Available |
Gene Name | SOD2 |
Protein Type | Enzyme |
Biological Properties | |
General Function | Inorganic ion transport and metabolism |
Specific Function | Destroys superoxide anion radicals which are normally produced within the cells and which are toxic to biological systems. |
Pathways | Not Available |
Reactions | Not Available |
GO Classification | Not Available |
Cellular Location | Not Available |
Gene Properties | |
Chromosome Location | 9 |
Locus | Not Available |
SNPs | SOD2 |
Gene Sequence | Not Available |
Protein Properties | |
Number of Residues | 222 |
Molecular Weight | 24638.0 |
Theoretical pI | 8.76 |
Pfam Domain Function | Not Available |
Signals |
|
Transmembrane Regions | Not Available |
Protein Sequence |
>Superoxide dismutase [Mn], mitochondrial MLSRAACSTSRRLVPALSVLGSRQKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVN NLNVAEEKYREALEKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPQGELLEA IKRDFGSFAKFKEKLTAVSVGVQGSGWGWLGFNKEQGRLQIAACSNQDPLQGTTGLIPLL GIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTARYTACSK |
External Links | |
GenBank ID Protein | AAA30655.1 |
UniProtKB/Swiss-Prot ID | P41976 |
UniProtKB/Swiss-Prot Entry Name | SODM_BOVIN |
PDB IDs | |
GenBank Gene ID | L22092 |
GeneCard ID | SOD2 |
GenAtlas ID | Not Available |
HGNC ID | Not Available |
References | |
General References | Not Available |