You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Bovine Metabolome Database.
Showing Protein Superoxide dismutase [Cu-Zn] (BMDBP00591)
Identification | |
---|---|
BMDB Protein ID | BMDBP00591 |
Secondary Accession Numbers |
|
Name | Superoxide dismutase [Cu-Zn] |
Synonyms | Not Available |
Gene Name | SOD1 |
Protein Type | Enzyme |
Biological Properties | |
General Function | Inorganic ion transport and metabolism |
Specific Function | Destroys radicals which are normally produced within the cells and which are toxic to biological systems. |
Pathways | Not Available |
Reactions | Not Available |
GO Classification | Not Available |
Cellular Location | Not Available |
Gene Properties | |
Chromosome Location | 1 |
Locus | 1q12-q14 |
SNPs | SOD1 |
Gene Sequence | Not Available |
Protein Properties | |
Number of Residues | 152 |
Molecular Weight | 15683.0 |
Theoretical pI | 6.3 |
Pfam Domain Function | Not Available |
Signals |
|
Transmembrane Regions |
|
Protein Sequence |
>Superoxide dismutase [Cu-Zn] MATKAVCVLKGDGPVQGTIHFEAKGDTVVVTGSITGLTEGDHGFHVHQFGDNTQGCTSAG PHFNPLSKKHGGPKDEERHVGDLGNVTADKNGVAIVDIVDPLISLSGEYSIIGRTMVVHE KPDDLGRGGNEESTKTGNAGSRLACGVIGIAK |
External Links | |
GenBank ID Protein | AAA73164.1 |
UniProtKB/Swiss-Prot ID | P00442 |
UniProtKB/Swiss-Prot Entry Name | SODC_BOVIN |
PDB IDs | |
GenBank Gene ID | X54799 |
GeneCard ID | SOD1 |
GenAtlas ID | Not Available |
HGNC ID | Not Available |
References | |
General References | Not Available |