Showing Protein Thymus HYPOCHOLESTEROLEMIC factor (TPHF) (Superoxide dismutase) (SOD) (BMDBP00592)
| Identification | |
|---|---|
| BMDB Protein ID | BMDBP00592 |
| Secondary Accession Numbers | None |
| Name | Thymus HYPOCHOLESTEROLEMIC factor (TPHF) (Superoxide dismutase) (SOD) |
| Synonyms | Not Available |
| Gene Name | Not Available |
| Protein Type | Enzyme |
| Biological Properties | |
| General Function | Inorganic ion transport and metabolism |
| Specific Function | Not Available |
| Pathways | Not Available |
| Reactions | Not Available |
| GO Classification | Not Available |
| Cellular Location | Not Available |
| Gene Properties | |
| Chromosome Location | Not Available |
| Locus | Not Available |
| SNPs | Not Available |
| Gene Sequence | Not Available |
| Protein Properties | |
| Number of Residues | 112 |
| Molecular Weight | 11344.0 |
| Theoretical pI | 5.54 |
| Pfam Domain Function | Not Available |
| Signals |
|
| Transmembrane Regions | Not Available |
| Protein Sequence |
>Superoxide dismutase [Cu-Zn] AVCVLKGDGPVQGTIHFEAKGDTVVVTGSITGLTHGGPKDEERHVGDLGNVTADKNGVAI VDIVDPLISLSGEYSIIGRTMVVHEKPDDLGRGGNTGNAGSRLACGVIGIAK |
| External Links | |
| GenBank ID Protein | Not Available |
| UniProtKB/Swiss-Prot ID | Q9TS96 |
| UniProtKB/Swiss-Prot Entry Name | Q9TS96_BOVIN |
| PDB IDs | Not Available |
| GenBank Gene ID | Not Available |
| GeneCard ID | Not Available |
| GenAtlas ID | Not Available |
| HGNC ID | Not Available |
| References | |
| General References | Not Available |