Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Bovine Metabolome Database.
Identification
BMDB Protein ID BMDBP00604
Secondary Accession Numbers
  • BMDBP03095
Name Beta-1,4-galactosyltransferase 1
Synonyms Not Available
Gene Name B4GALT1
Protein Type Enzyme
Biological Properties
General Function Involved in alpha-tubulin binding
Specific Function The Golgi complex form catalyzes the production of lactose in the lactating mammary gland and could also be responsible for the synthesis of complex-type N-linked oligosaccharides in many glycoproteins as well as the carbohydrate moieties of glycolipids.
Pathways
  • Protein glycosylation
  • Protein modification
Reactions
Uridine diphosphategalactose + D-Glucose → Uridine 5'-diphosphate + Alpha-Lactose details
D-Glucose + Uridine diphosphategalactose → Uridine 5'-diphosphate + Alpha-Lactose details
GO Classification Not Available
Cellular Location Not Available
Gene Properties
Chromosome Location 8
Locus Not Available
SNPs B4GALT1
Gene Sequence
>1209 bp
ATGAAGTTTCGGGAGCCGCTCCTGGGCGGCAGTGCCGCGATGCCGGGCGCGTCCCTGCAG
CGGGCCTGCCGCCTCCTCGTGGCTGTCTGCGCCCTGCATCTTGGCGTCACCCTCGTCTAT
TACCTGGCCGGCCGAGACCTAAGACGCCTGCCTCAGCTGGTCGGAGTCCACCCACCGCTT
CAGGGAAGCTCTCACGGCGCCGCCGCTATCGGGCAGCCCTCCGGGGAGCTCCGGCTGCGA
GGGGTCGCACCGCCGCCGCCTTTGCAGAACTCTTCCAAGCCGCGCTCGCGGGCCCCCTCC
AACCTAGACGCGTACTCTCACCCCGGCCCTGGCCCGGGCCCGGGGAGCAACTTGACTTCG
GCCCCAGTGCCCTCCACCACAACACGCTCGCTGACCGCATGCCCTGAGGAGTCCCCGCTG
CTCGTCGGCCCCATGCTGATTGAGTTTAACATACCTGTGGACCTGAAGCTTATCGAGCAG
CAGAACCCGAAGGTGAAGTTGGGTGGTCGCTACACCCCCATGGACTGCATCTCTCCTCAC
AAGGTGGCCATCATCATTCTATTCCGCAACCGGCAGGAACACCTCAAGTACTGGCTGTAT
TACTTGCACCCAATGGTACAGCGTCAGCAGTTAGACTATGGCATCTATGTTATCAACCAG
GCTGGAGAGTCCATGTTCAACCGCGCAAAGCTCCTCAATGTTGGCTTTAAAGAGGCCTTG
AAGGACTATGACTACAACTGCTTTGTGTTTAGCGATGTGGACCTCATCCCAATGAACGAC
CATAACACCTACAGGTGCTTTTCACAGCCACGGCACATTTCTGTAGCAATGGATAAGTTT
GGATTTAGCCTACCTTACGTGCAGTATTTTGGAGGTGTCTCTGCTCTAAGTAAACAACAG
TTTCTCAGCATCAATGGATTTCCTAATAACTACTGGGGCTGGGGAGGTGAAGATGATGAC
ATTTATAACAGATTAGCTTTTAGAGGCATGTCTGTGTCTCGCCCAAATGCTGTGATCGGG
AAGTGTCGGATGATCCGCCACTCGAGAGACAAGAAAAATGAACCTAATCCTCAGAGGTTT
GACCGAATTGCACATACAAAGGAGACAATGCTCTCTGATGGTTTGAACTCACTCACCTAC
ATGGTGTTAGAGGTCCAGAGGTACCCGTTGTATACCAAAATCACAGTGGACATCGGGACG
CCGAGCTAG
Protein Properties
Number of Residues 402
Molecular Weight 44843.0
Theoretical pI 9.6
Pfam Domain Function Not Available
Signals
  • None
Transmembrane Regions
  • 25-44
Protein Sequence
>Beta-1,4-galactosyltransferase 1
MKFREPLLGGSAAMPGASLQRACRLLVAVCALHLGVTLVYYLAGRDLRRLPQLVGVHPPL
QGSSHGAAAIGQPSGELRLRGVAPPPPLQNSSKPRSRAPSNLDAYSHPGPGPGPGSNLTS
APVPSTTTRSLTACPEESPLLVGPMLIEFNIPVDLKLVEQQNPKVKLGGRYTPMDCISPH
KVAIIIPFRNRQEHLKYWLYYLHPILQRQQLDYGIYVINQAGESMFNRAKLLNVGFKEAL
KDYDYNCFVFSDVDLIPMNDHNTYRCFSQPRHISVAMDKFGFSLPYVQYFGGVSALSKQQ
FLSINGFPNNYWGWGGEDDDIYNRLAFRGMSVSRPNAVIGKCRMIRHSRDKKNEPNPQRF
DRIAHTKETMLSDGLNSLTYMVLEVQRYPLYTKITVDIGTPS
GenBank ID Protein CAA32695.1
UniProtKB/Swiss-Prot ID P08037
UniProtKB/Swiss-Prot Entry Name B4GT1_BOVIN
PDB IDs
GenBank Gene ID X14558
GeneCard ID B4GALT1
GenAtlas ID Not Available
HGNC ID Not Available
References
General References Not Available