Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Bovine Metabolome Database.
Identification
BMDB Protein ID BMDBP00609
Secondary Accession Numbers None
Name Transketolase
Synonyms Not Available
Gene Name TKT
Protein Type Enzyme
Biological Properties
General Function Energy production and conversion
Specific Function Catalyzes the transfer of a two-carbon ketol group from a ketose donor to an aldose acceptor, via a covalent intermediate with the cofactor thiamine pyrophosphate.
Pathways
  • Pentose Phosphate Pathway
  • Warburg Effect
Reactions
D-Erythrose 4-phosphate + Xylulose 5-phosphate → Fructose 6-phosphate + D-Glyceraldehyde 3-phosphate details
GO Classification Not Available
Cellular Location Not Available
Gene Properties
Chromosome Location 22
Locus Not Available
SNPs TKT
Gene Sequence
>1872 bp
ATGGAGGCCTACCATAAGCCTGATCAGCAGAAGCTGCAGGCCCTGAAGGACACGGCCAAC
CGCCTGCGTATCAGCTCCATCCAAGCCACCACGGCGGCCGGATCGGGCCACCCCACGTCA
TGCTGCAGCGCTGCTGAGATCATGGCTGTCCTCTTCTTCCACACCATGCGCTACAAGGCC
CTGGATCCCCGGAACCCTCACAACGACCGCTTTGTTCTCTCCAAGGGCCATGCGGCACCC
ATCCTGTATGCCGTCTGGGCTGAAGCTGGCTTCCTGCCGGAGTCAGAGCTGCTGAATCTG
AGGAAGATCAACTCCGACTTGGACGGGCACCCTGTCCCGAAACAAGCCTTCACCGATGTG
GCCACTGGCTCCCTGGGCCAGGGCCTTGGAGCCGCTTGCGGGATGGCCTACACAGGCAAA
TACTTCGACAAAGCCAGCTACCGGGTCTATTGCATGCTGGGAGACGGGGAGCTGTCAGAG
GGCTCCGTGTGGGAGGCCATGGCCTTCGCCAGCATCTACAAGCTGGACAACCTTGTCGCC
ATCCTTGACATCAACCGCCTGGGCCAGAGTGACCCTGCCCCGCTGCAGCACCAGATGGAC
ATCTACCAGAAGCGCTGCGAGGCCTTCGGTTGGAACGCTGTCATCGTAGATGGGCACAGC
GTGGAGGAACTGTGCAAGGCCTTCGGGCAGGTGAAGAACCAGCCAACAGCCATCATTGCC
AAGACCTTCAAGGGCCGAGGCATCACAGGGATAGAAGATAAGGAGTCTTGGCATGGGAAG
CCCCTCCCCAAAAATATGGCCGATCAGATCATCCAGGAAATCTCCGGTCAGATCCAGAGC
AAGAAGAAGATCCTGGCGACCCCCCCAGAGGAGGACGCCCCCTCAGTGGACATCACCAAC
ATCCGAATGCCCACCCCACCCAACTACAAAGTTGGGGACAAGATAGCTACCCGCAAGGCC
TACGGACAGGCCCTGGCCAAGCTGGGTCATGCCAGCAACCGCATCATTGCCCTGGATGGG
GACACCAAGAACTCCACCTTCTCAGAACTCTTCAAAAAGGAGCACCCGGACCGTTTCATT
GAGTGTTACATTGCTGAGCAGAACATGGTGAGCATCGCCGTGGGCTGTGCCACACGCGAC
AGGACGGTACCCTTCTGCAGCACCTTCGCAGCCTTCTTTACACGGGCCTTCGACCAGATT
CGCATGGCAGCCATCTCCGAGAGCAACATCAACCTCTGCGGCTCCCACTGCGGCGTGTCC
ATTGGAGAAGACGGGCCCTCCCAGATGGCCCTGGAAGATCTGGCCATGTTTCGGTCTATC
CCCATGTCAACTGTCTTTTACCCAAGTGATGGGGTGGCTACGGAGAAGGCAGTAGAATTA
GCAGCCAATACAAAGGGTATCTGCTTCATCCGGACCAGCCGCCCAGAAAATGCCATCATC
TACAAACAACATGAAGATTTCCAAATCGGACAAGCCAAGGTGGTCCTGAAGAACAAGGAT
GACCAGGTGACTGTGATTGGTGCCGGGGTGACCCTGCACGAGGCTTTGGCAGCTGCTGAC
CTGCTGAAGAGAGAGAAGATCAACATTCGCGTATTGGACCCTTTCACCATCAAGCCCCTG
GATAAGAAGCTCATTCTTGACAGTGCCCGTGCTACCAAGGGCAGGATCCTCACTGTGGAG
GACCACTACTATGAAGGTGGCATAGGTGAGGCAGTGGCCTCTGCAGTTGTGGGAGAGCCT
GGCGTCACTGTCACCCGCCTGGCAGTCAGCCAGGTGCCCAGAAGCGGGAAACCAGCGGAG
CTGCTGAAGATGTTTGGCATTGACAGGGATGCCATCGCGCAGGCCGTGCGGGGCCTGGTG
ACCAGGGCCTAG
Protein Properties
Number of Residues 623
Molecular Weight 67906.0
Theoretical pI 7.71
Pfam Domain Function Not Available
Signals
  • None
Transmembrane Regions Not Available
Protein Sequence
>Transketolase
MEAYHKPDQQKLQALKDTANRLRISSIQATTAAGSGHPTSCCSAAEIMAVLFFHTMRYKA
LDPRNPHNDRFVLSKGHAAPILYAVWAEAGFLPESELLNLRKINSDLDGHPVPKQAFTDV
ATGSLGQGLGAACGMAYTGKYFDKASYRVYCMLGDGELSEGSVWEAMAFASIYKLDNLVA
ILDINRLGQSDPAPLQHQMDIYQKRCEAFGWNAVIVDGHSVEELCKAFGQVKNQPTAIIA
KTFKGRGITGIEDKESWHGKPLPKNMADQIIQEISGQIQSKKKILATPPEEDAPSVDITN
IRMPTPPNYKVGDKIATRKAYGQALAKLGHASNRIIALDGDTKNSTFSELFKKEHPDRFI
ECYIAEQNMVSIAVGCATRDRTVPFCSTFAAFFTRAFDQIRMAAISESNINLCGSHCGVS
IGEDGPSQMALEDLAMFRSIPMSTVFYPSDGVATEKAVELAANTKGICFIRTSRPENAII
YKQHEDFQIGQAKVVLKNKDDQVTVIGAGVTLHEALAAADLLKREKINIRVLDPFTIKPL
DKKLILDSARATKGRILTVEDHYYEGGIGEAVASAVVGEPGVTVTRLAVSQVPRSGKPAE
LLKMFGIDRDAIAQAVRGLVTRA
GenBank ID Protein AAT84375.1
UniProtKB/Swiss-Prot ID Q6B855
UniProtKB/Swiss-Prot Entry Name TKT_BOVIN
PDB IDs Not Available
GenBank Gene ID AY675082
GeneCard ID TKT
GenAtlas ID Not Available
HGNC ID Not Available
References
General References Not Available