Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Bovine Metabolome Database.
Identification
BMDB Protein ID BMDBP00618
Secondary Accession Numbers
  • BMDBP03027
Name D-aspartate oxidase
Synonyms Not Available
Gene Name DDO
Protein Type Enzyme
Biological Properties
General Function Amino acid transport and metabolism
Specific Function Not Available
Pathways Not Available
Reactions
D-Aspartic acid + Water + Oxygen → Oxalacetic acid + Ammonia + Hydrogen peroxide details
D-Proline + Water + Oxygen → 1-Pyrroline-2-carboxylic acid + Ammonia + Hydrogen peroxide details
Hydroxyproline + Water + Oxygen → 1-Pyrroline-4-hydroxy-2-carboxylate + Ammonia + Hydrogen peroxide details
D-Ornithine + Water + Oxygen → 5-Amino-2-oxopentanoic acid + Ammonia + Hydrogen peroxide details
D-Arginine + Water + Oxygen → 2-Oxoarginine + Ammonia + Hydrogen peroxide details
GO Classification Not Available
Cellular Location Not Available
Gene Properties
Chromosome Location 9
Locus Not Available
SNPs DDO
Gene Sequence
>1026 bp
ATGGATACAGTACGGATTGCAGTTGTGGGGGCTGGCGTGATGGGGCTTTCTACCGCTGTG
TGCATTTCCAAAATGGTCCCAGGATGCTCCATTACAGTCATTTCAGACAAATTCACTCCT
GAGACCACGAGTGATGTGGCAGCTGGAATGCTTATTCCTCCTACTTATCCAGACACACCC
ATTCAGAAGCAGAAGCAGTGGTTCAAAGAGACCTTTGATCACCTGTTTGCAATAGTCAAT
TCTGCAGAAGCTGAAGATGCTGGTGTTATTTTGGTGTCTGGTTGGCAGATATTTCAGAGT
ATTCCTACTGAAGAAGTGCCATACTGGGCTGACGTGGTGCTAGGATTTCGAAAGATGACC
AAGGATGAGCTGAAGAAATTCCCCCAACATGTGTTTGGTCATGCTTTTACGACACTCAAG
TGTGAAGGCCCTGCCTACCTCCCGTGGTTGCAGAAAAGGGTAAAAGGAAATGGGGGCCTG
ATACTCACCCGACGAATAGAAGACCTGTGGGAGCTTCACCCGTCCTTCGACATCGTGGTC
AACTGTTCAGGCCTTGGAAGCAGGCAGCTTGCAGGAGACTCAAAGATTTTCCCAGTGAGG
GGCCAAGTACTCAAAGTGCAGGCTCCCTGGGTCAAGCACTTTATCCGAGATAGCAGTGGG
CTGACATATATTTACCCTGGCGTATCCAATGTAACCCTGGGTGGCACTAGGCAAAAAGGA
GACTGGAATTTGTCCCCAGATGCAGAAATTAGCAAAGAGATTCTTTCCCGATGCTGTGCC
CTCGAGCCCTCTCTCCGTGGAGCCTATGACCTAAGAGAGAAAGTGGGTTTGAGGCCCACT
AGGCCAAGCGTACGGCTGGAGAAAGAGCTACTAGCTCAGGACAGCCGGAGGCTGCCTGTG
GTCCATCACTATGGCCATGGAAGTGGGGGCATCGCCATGCACTGGGGCACTGCTCTGGAG
GCCACCAGGCTGGTGAACGAGTGTGTCCAAGTCCTTAGGACTCCTGCTCCCAAGTCAAAG
CTGTAG
Protein Properties
Number of Residues 341
Molecular Weight 37660.0
Theoretical pI 8.84
Pfam Domain Function Not Available
Signals
  • None
Transmembrane Regions Not Available
Protein Sequence
>D-aspartate oxidase
MDTVRIAVVGAGVMGLSTAVCISKMVPGCSITVISDKFTPETTSDVAAGMLIPPTYPDTP
IQKQKQWFKETFDHLFAIVNSAEAEDAGVILVSGWQIFQSIPTEEVPYWADVVLGFRKMT
KDELKKFPQHVFGHAFTTLKCEGPAYLPWLQKRVKGNGGLILTRRIEDLWELHPSFDIVV
NCSGLGSRQLAGDSKIFPVRGQVLKVQAPWVKHFIRDSSGLTYIYPGVSNVTLGGTRQKG
DWNLSPDAEISKEILSRCCALEPSLRGAYDLREKVGLRPTRPSVRLEKELLAQDSRRLPV
VHHYGHGSGGIAMHWGTALEATRLVNECVQVLRTPAPKSKL
GenBank ID Protein CAA64622.1
UniProtKB/Swiss-Prot ID P31228
UniProtKB/Swiss-Prot Entry Name OXDD_BOVIN
PDB IDs Not Available
GenBank Gene ID X95310
GeneCard ID DDO
GenAtlas ID Not Available
HGNC ID Not Available
References
General References Not Available