Showing Protein Acyl-CoA desaturase (BMDBP00670)
| Identification | |
|---|---|
| BMDB Protein ID | BMDBP00670 |
| Secondary Accession Numbers | None |
| Name | Acyl-CoA desaturase |
| Synonyms | Not Available |
| Gene Name | SCD |
| Protein Type | Enzyme |
| Biological Properties | |
| General Function | Energy production and conversion |
| Specific Function | Stearyl-CoA desaturase that utilizes O(2) and electrons from reduced cytochrome b5 to introduce the first double bond into saturated fatty acyl-CoA substrates. Catalyzes the insertion of a cis double bond at the delta-9 position into fatty acyl-CoA substrates including palmitoyl-CoA and stearoyl-CoA (By similarity). Gives rise to a mixture of 16:1 and 18:1 unsaturated fatty acids. Plays an important role in lipid biosynthesis. Plays an important role in regulating the expression of genes that are involved in lipogenesis and in regulating mitochondrial fatty acid oxidation (By similarity). Plays an important role in body energy homeostasis (By similarity). Contributes to the biosynthesis of membrane phospholipids, cholesterol esters and triglycerides (By similarity). |
| Pathways | Not Available |
| Reactions | Not Available |
| GO Classification | Not Available |
| Cellular Location | Not Available |
| Gene Properties | |
| Chromosome Location | 26 |
| Locus | Not Available |
| SNPs | SCD |
| Gene Sequence | Not Available |
| Protein Properties | |
| Number of Residues | 359 |
| Molecular Weight | 41705.0 |
| Theoretical pI | 9.47 |
| Pfam Domain Function | Not Available |
| Signals |
|
| Transmembrane Regions |
|
| Protein Sequence |
>Acyl-CoA desaturase MPAHLLQEEISSSYTTTTTITAPPSRVLQNGGGKLEKTPLYLEEDIRPEMRDDIYDPTYQ DKEGPKPKLEYVWRNIILMSLLHLGALYGITLIPTCKIYTYIWVLFYYLMGALGITAGAH RLWSHRTYKARLPLRVFLIIGNTMAFQNDVFEWSRDHRAHHKFSETDADPHNSRRGFFFS HVGWLLVRKHPAVKEKGSTLNLSDLRAEKLVMFQRRYYKPGVLLLCFILPTLVPWYLWDE TFQNSLFFATLFRYALGLNVTWLVNSAAHMYGYRPYDKTINPRENILVSLGAAGEGFHNY HHTFPYDYSASEYRWHINFTTFFIDCMAAIGLAYDRKKVSKAAILARIKRTGEESYKSG |
| External Links | |
| GenBank ID Protein | AAF22305.1 |
| UniProtKB/Swiss-Prot ID | Q9TT94 |
| UniProtKB/Swiss-Prot Entry Name | ACOD_BOVIN |
| PDB IDs | Not Available |
| GenBank Gene ID | AF188710 |
| GeneCard ID | SCD |
| GenAtlas ID | Not Available |
| HGNC ID | Not Available |
| References | |
| General References | Not Available |