Showing Protein Deoxyhypusine hydroxylase (BMDBP00672)
| Identification | |
|---|---|
| BMDB Protein ID | BMDBP00672 |
| Secondary Accession Numbers | None |
| Name | Deoxyhypusine hydroxylase |
| Synonyms | Not Available |
| Gene Name | DOHH |
| Protein Type | Enzyme |
| Biological Properties | |
| General Function | Energy production and conversion |
| Specific Function | Catalyzes the hydroxylation of the N(6)-(4-aminobutyl)-L-lysine intermediate produced by deoxyhypusine synthase/DHPS on a critical lysine of the eukaryotic translation initiation factor 5A/eIF-5A. This is the second step of the post-translational modification of that lysine into an unusual amino acid residue named hypusine. Hypusination is unique to mature eIF-5A factor and is essential for its function. |
| Pathways |
|
| Reactions | Not Available |
| GO Classification | Not Available |
| Cellular Location | Not Available |
| Gene Properties | |
| Chromosome Location | 7 |
| Locus | Not Available |
| SNPs | DOHH |
| Gene Sequence | Not Available |
| Protein Properties | |
| Number of Residues | 303 |
| Molecular Weight | 33261.0 |
| Theoretical pI | 4.6 |
| Pfam Domain Function | Not Available |
| Signals |
|
| Transmembrane Regions |
|
| Protein Sequence |
>Deoxyhypusine hydroxylase MVTEQEVEAVGQTLVDPGQPLQARFRALFTLRGLGGPVAISWISRAFDDDSALLKHELAY CLGQMQDRRAIPVLLDVLRDTRQEPMVRHEAGEALGAIGDPEVLEILKQYSTDPVVEVAE TCQLAVRRLEWLQQHGGESAVRGPYLSVDPAPPAEERDLGQLREALLDEARPLFDRYRAM FALRDAGGKEAALALAEGLRCGSALFRHEIGYVLGQMQHEAAVPQLAAALAQPTENPMVR HECAEALGAIARPACLAALRAHVADPERVVRESCEVALDMYEYETGSTFQYADGLERLRS PLS |
| External Links | |
| GenBank ID Protein | ABL86660.1 |
| UniProtKB/Swiss-Prot ID | Q0VC53 |
| UniProtKB/Swiss-Prot Entry Name | DOHH_BOVIN |
| PDB IDs | Not Available |
| GenBank Gene ID | DQ990881 |
| GeneCard ID | DOHH |
| GenAtlas ID | Not Available |
| HGNC ID | Not Available |
| References | |
| General References | Not Available |