Showing Protein Glyceraldehyde-3-phosphate dehydrogenase like-17 protein (BMDBP00692)
| Identification | |
|---|---|
| BMDB Protein ID | BMDBP00692 |
| Secondary Accession Numbers | None |
| Name | Glyceraldehyde-3-phosphate dehydrogenase like-17 protein |
| Synonyms | Not Available |
| Gene Name | GAPDL17 |
| Protein Type | Enzyme |
| Biological Properties | |
| General Function | Carbohydrate transport and metabolism |
| Specific Function | Not Available |
| Pathways | Not Available |
| Reactions | Not Available |
| GO Classification | Not Available |
| Cellular Location | Not Available |
| Gene Properties | |
| Chromosome Location | 5 |
| Locus | Not Available |
| SNPs | GAPDL17 |
| Gene Sequence | Not Available |
| Protein Properties | |
| Number of Residues | 109 |
| Molecular Weight | 11514.0 |
| Theoretical pI | 9.42 |
| Pfam Domain Function | Not Available |
| Signals |
|
| Transmembrane Regions | Not Available |
| Protein Sequence |
>Glyceraldehyde 3-phosphate dehydrogenase GAHLKGGAKRVIISAPSADAPMFVMGFNHEKYNNTLKIVSNASCTTNCLAPLAKVIHDHF GIVEGLMTTVHAITATPEECGWPPPGKLWRDGRRAAQNIIPASTGPAKA |
| External Links | |
| GenBank ID Protein | AAD31378.1 |
| UniProtKB/Swiss-Prot ID | Q9XSN4 |
| UniProtKB/Swiss-Prot Entry Name | Q9XSN4_BOVIN |
| PDB IDs | Not Available |
| GenBank Gene ID | U85481 |
| GeneCard ID | GAPDL17 |
| GenAtlas ID | Not Available |
| HGNC ID | Not Available |
| References | |
| General References | Not Available |