Showing Protein Lysozyme C-3 (BMDBP00700)
| Identification | |
|---|---|
| BMDB Protein ID | BMDBP00700 |
| Secondary Accession Numbers | None |
| Name | Lysozyme C-3 |
| Synonyms | Not Available |
| Gene Name | LYZ3 |
| Protein Type | Enzyme |
| Biological Properties | |
| General Function | Involved in lysozyme activity |
| Specific Function | Lysozymes have primarily a bacteriolytic function; those in tissues and body fluids are associated with the monocyte-macrophage system and enhance the activity of immunoagents. |
| Pathways | Not Available |
| Reactions | Not Available |
| GO Classification | Not Available |
| Cellular Location | Not Available |
| Gene Properties | |
| Chromosome Location | 5 |
| Locus | 5q23 |
| SNPs | LYZ3 |
| Gene Sequence | Not Available |
| Protein Properties | |
| Number of Residues | 147 |
| Molecular Weight | 16317.0 |
| Theoretical pI | 7.7 |
| Pfam Domain Function | Not Available |
| Signals |
|
| Transmembrane Regions | Not Available |
| Protein Sequence |
>Lysozyme C-3 MKALIILGFLFLSVAVQGKVFERCELARTLKKLGLDGYKGVSLANWLCLTKWESSYNTKA TNYNPSSESTDYGIFQINSKWWCNDGKTPNAVDGCHVSCSELMENDIAKAVACAKHIVSE QGITAWVAWKSHCRDHDVSSYVQGCTL |
| External Links | |
| GenBank ID Protein | AAC37312.1 |
| UniProtKB/Swiss-Prot ID | Q06284 |
| UniProtKB/Swiss-Prot Entry Name | LYSC3_BOVIN |
| PDB IDs | Not Available |
| GenBank Gene ID | M95099 |
| GeneCard ID | LYZ3 |
| GenAtlas ID | Not Available |
| HGNC ID | Not Available |
| References | |
| General References | Not Available |