Showing Protein Lysozyme C, non-stomach isozyme (BMDBP00704)
| Identification | |
|---|---|
| BMDB Protein ID | BMDBP00704 |
| Secondary Accession Numbers | None |
| Name | Lysozyme C, non-stomach isozyme |
| Synonyms | Not Available |
| Gene Name | LYS |
| Protein Type | Enzyme |
| Biological Properties | |
| General Function | Involved in lysozyme activity |
| Specific Function | Lysozymes have primarily a bacteriolytic function; those in tissues and body fluids are associated with the monocyte-macrophage system and enhance the activity of immunoagents. |
| Pathways | Not Available |
| Reactions | Not Available |
| GO Classification | Not Available |
| Cellular Location | Not Available |
| Gene Properties | |
| Chromosome Location | 5 |
| Locus | Not Available |
| SNPs | LYS |
| Gene Sequence | Not Available |
| Protein Properties | |
| Number of Residues | 148 |
| Molecular Weight | 16476.0 |
| Theoretical pI | 7.98 |
| Pfam Domain Function | Not Available |
| Signals |
|
| Transmembrane Regions | Not Available |
| Protein Sequence |
>Lysozyme C, non-stomach isozyme MKALLILGLLLFSVAVQGKVFERCELARSLKRFGMDNFRGISLANWMCLARWESNYNTQA TNYNAGDQSTDYGIFQINSHWWCNDGKTPGAVNACHLPCGALLQDDITQAVACAKRVVSD PQGIRAWVAWRSHCQNQDLTSYIQGCGV |
| External Links | |
| GenBank ID Protein | AAC48683.1 |
| UniProtKB/Swiss-Prot ID | P80189 |
| UniProtKB/Swiss-Prot Entry Name | LYSCN_BOVIN |
| PDB IDs | Not Available |
| GenBank Gene ID | L23757 |
| GeneCard ID | LYS |
| GenAtlas ID | Not Available |
| HGNC ID | Not Available |
| References | |
| General References | Not Available |