Showing Protein Lysozyme C-1 (BMDBP00707)
Identification | |
---|---|
BMDB Protein ID | BMDBP00707 |
Secondary Accession Numbers | None |
Name | Lysozyme C-1 |
Synonyms | Not Available |
Gene Name | LYZ1 |
Protein Type | Enzyme |
Biological Properties | |
General Function | Involved in lysozyme activity |
Specific Function | Lysozymes have primarily a bacteriolytic function; those in tissues and body fluids are associated with the monocyte-macrophage system and enhance the activity of immunoagents. |
Pathways | Not Available |
Reactions | Not Available |
GO Classification | Not Available |
Cellular Location | Not Available |
Gene Properties | |
Chromosome Location | 5 |
Locus | Not Available |
SNPs | LYZ1 |
Gene Sequence | Not Available |
Protein Properties | |
Number of Residues | 147 |
Molecular Weight | 16279.0 |
Theoretical pI | 7.24 |
Pfam Domain Function | Not Available |
Signals |
|
Transmembrane Regions | Not Available |
Protein Sequence |
>Lysozyme C-1 MKALIILGFLFLSVAVQGKVFERCELARTLKKLGLDGYKGVSLANWLCLTKWESSYNTKA TNYNPGSESTDYGIFQINSKWWCNDGKTPNAVDGCHVSCSELMENDIAKAVACAKQIVSE QGITAWVAWKSHCRDHDVSSYVEGCTL |
External Links | |
GenBank ID Protein | AAC37310.1 |
UniProtKB/Swiss-Prot ID | Q06285 |
UniProtKB/Swiss-Prot Entry Name | LYSC1_BOVIN |
PDB IDs | Not Available |
GenBank Gene ID | M95097 |
GeneCard ID | LYZ1 |
GenAtlas ID | Not Available |
HGNC ID | Not Available |
References | |
General References | Not Available |