Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Bovine Metabolome Database.
Identification
BMDB Protein ID BMDBP00716
Secondary Accession Numbers None
Name Retinol dehydrogenase 10
Synonyms Not Available
Gene Name RDH10
Protein Type Enzyme
Biological Properties
General Function Lipid transport and metabolism
Specific Function Retinol dehydrogenase with a clear preference for NADP. Converts all-trans-retinol to all-trans-retinal. Has no detectable activity towards 11-cis-retinol, 9-cis-retinol and 13-cis-retinol (By similarity).
Pathways
  • Cofactor metabolism
  • Retinol Metabolism
Reactions Not Available
GO Classification Not Available
Cellular Location Not Available
Gene Properties
Chromosome Location 14
Locus Not Available
SNPs RDH10
Gene Sequence
>1026 bp
ATGAACATCGTGGTGGAGTTCTTCGTGGTCACTTTCAAAGTGCTTTGGGCGTTCGTGCTG
GCCGCTGCGCGCTGGTTGGTGCGGCCCAAGGAGAAGAGCGTGGCCGGCCAGGTGTGCCTC
ATTACGGGCGCCGGCAGCGGCCTGGGCCGCCTCTTCGCGCTCGAGTTCGCCCGACGCCGG
GCGCTGCTGGTGCTCTGGGACATCAACACCCAGAGCAACGAGGAGACGGCGGGCATGGTG
CGCCACATCTACCGCGACCTGGAGGCGGCCGACGCCGCGGCGCTGCAAGCTGGGAATGGT
GAGGAAGAAATTCTGCCCCACTGTAACTTGCAGGTTTTTACCTACACCTGTGATGTGGGA
AAGAGGGAGAACGTCTACCTGACAGCGGAAAGGGTCCGGAAGGAAGTCGGTGAGGTCTCT
GTCCTGGTCAATAACGCCGGTGTGGTGTCTGGGCATCACCTCCTGGAATGTCCCGATGAG
CTCATTGAGAGAACCATGATGGTCAATTGCCACGCACACTTCTGGACCACTAAGGCTTTT
CTTCCTACCATGCTGGAGATTAATCATGGTCATATTGTGACAGTTGCAAGTTCCTTGGGA
TTGTTCAGCACTGCTGGAGTTGAGGACTACTGCGCCAGTAAATTTGGAGTCGTGGGTTTT
CATGAATCCCTGAGCCATGAGTTAAAGGCCGCAGAGAAGGATGGAATTAAAACAACGTTG
GTCTGCCCTTACCTGGTGGACACTGGCATGTTCAGGGGCTGCCGAATCAGGAAAGAAATC
GAGCCTTTCCTGCCCCCTCTGAAGCCCGACTACTGCGTGAAGCAGGCCATGAAGGCCATC
CTCACCGACCAGCCCATGATCTGCACGCCCCGCCTCATGTACATCGTGACCTTCATGAAG
AGCATCCTCCCTTTTGAAGCAGTTGTGTGCATGTATCGGTTCCTAGGAGCAGACAAGTGT
ATGTACCCCTTTATCGCTCAAAGGAAACAAGCCACAAACAACAACGAAGCGAAAAACGGA
ATCTGA
Protein Properties
Number of Residues 341
Molecular Weight 38087.0
Theoretical pI 7.44
Pfam Domain Function Not Available
Signals
  • None
Transmembrane Regions
  • 3-23
Protein Sequence
>Retinol dehydrogenase 10
MNIVVEFFVVTFKVLWAFVLAAARWLVRPKEKSVAGQVCLITGAGSGLGRLFALEFARRR
ALLVLWDINTQSNEETAGMVRHIYRDLEAADAAALQAGNGEEEILPHCNLQVFTYTCDVG
KRENVYLTAERVRKEVGEVSVLVNNAGVVSGHHLLECPDELIERTMMVNCHAHFWTTKAF
LPTMLEINHGHIVTVASSLGLFSTAGVEDYCASKFGVVGFHESLSHELKAAEKDGIKTTL
VCPYLVDTGMFRGCRIRKEIEPFLPPLKPDYCVKQAMKAILTDQPMICTPRLMYIVTFMK
SILPFEAVVCMYRFLGADKCMYPFIAQRKQATNNNEAKNGI
GenBank ID Protein AAN64748.1
UniProtKB/Swiss-Prot ID Q8HZT6
UniProtKB/Swiss-Prot Entry Name RDH10_BOVIN
PDB IDs Not Available
GenBank Gene ID AF456766
GeneCard ID RDH10
GenAtlas ID Not Available
HGNC ID Not Available
References
General References Not Available