Identification
BMDB Protein ID BMDBP00717
Secondary Accession Numbers None
Name ATP synthase subunit f, mitochondrial
Synonyms Not Available
Gene Name ATP5MF
Protein Type Enzyme
Biological Properties
General Function Involved in hydrogen ion transmembrane transporter acti
Specific Function Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(0) domain. Minor subunit located with subunit a in the membrane.
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location Not Available
Gene Properties
Chromosome Location 25
Locus Not Available
SNPs ATP5MF
Gene Sequence
>120 bp
ATGGCGTCAGTCGTACCACTGAAGGAGAAGAAGCTCCTGGAAGTCAAACTAGGGGAGTTG
CCAAGCTGGATACTGATGCGGGATTTCACCCCTTCAGGCATCGCTGGAGCATTTCAAAGA
Protein Properties
Number of Residues 88
Molecular Weight 10297.0
Theoretical pI 10.31
Pfam Domain Function Not Available
Signals
  • None
Transmembrane Regions
  • 55-72
Protein Sequence
>ATP synthase subunit f, mitochondrial
MASVVPLKEKKLLEVKLGELPSWILMRDFTPSGIAGAFQRGYYRYYNKYVNVKKGSIAGL
SMVLAAYVFLNYCRSYKELKHERLRKYH
GenBank ID Protein AAB31107.2
UniProtKB/Swiss-Prot ID Q28851
UniProtKB/Swiss-Prot Entry Name ATPK_BOVIN
PDB IDs Not Available
GenBank Gene ID S70447
GeneCard ID ATP5MF
GenAtlas ID Not Available
HGNC ID Not Available
References
General References Not Available