You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Bovine Metabolome Database.
Showing Protein ATP synthase subunit f, mitochondrial (BMDBP00717)
| Identification | |
|---|---|
| BMDB Protein ID | BMDBP00717 |
| Secondary Accession Numbers | None |
| Name | ATP synthase subunit f, mitochondrial |
| Synonyms | Not Available |
| Gene Name | ATP5MF |
| Protein Type | Enzyme |
| Biological Properties | |
| General Function | Involved in hydrogen ion transmembrane transporter acti |
| Specific Function | Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(0) domain. Minor subunit located with subunit a in the membrane. |
| Pathways | Not Available |
| Reactions | Not Available |
| GO Classification | Not Available |
| Cellular Location | Not Available |
| Gene Properties | |
| Chromosome Location | 25 |
| Locus | Not Available |
| SNPs | ATP5MF |
| Gene Sequence |
>120 bp ATGGCGTCAGTCGTACCACTGAAGGAGAAGAAGCTCCTGGAAGTCAAACTAGGGGAGTTG CCAAGCTGGATACTGATGCGGGATTTCACCCCTTCAGGCATCGCTGGAGCATTTCAAAGA |
| Protein Properties | |
| Number of Residues | 88 |
| Molecular Weight | 10297.0 |
| Theoretical pI | 10.31 |
| Pfam Domain Function | Not Available |
| Signals |
|
| Transmembrane Regions |
|
| Protein Sequence |
>ATP synthase subunit f, mitochondrial MASVVPLKEKKLLEVKLGELPSWILMRDFTPSGIAGAFQRGYYRYYNKYVNVKKGSIAGL SMVLAAYVFLNYCRSYKELKHERLRKYH |
| External Links | |
| GenBank ID Protein | AAB31107.2 |
| UniProtKB/Swiss-Prot ID | Q28851 |
| UniProtKB/Swiss-Prot Entry Name | ATPK_BOVIN |
| PDB IDs | Not Available |
| GenBank Gene ID | S70447 |
| GeneCard ID | ATP5MF |
| GenAtlas ID | Not Available |
| HGNC ID | Not Available |
| References | |
| General References | Not Available |