Showing Protein Similar to ATP synthase A chain (Protein 6) (BMDBP00721)
| Identification | |
|---|---|
| BMDB Protein ID | BMDBP00721 |
| Secondary Accession Numbers | None |
| Name | Similar to ATP synthase A chain (Protein 6) |
| Synonyms | Not Available |
| Gene Name | Not Available |
| Protein Type | Enzyme |
| Biological Properties | |
| General Function | Involved in hydrogen ion transmembrane transporter acti |
| Specific Function | Not Available |
| Pathways | Not Available |
| Reactions | Not Available |
| GO Classification | Not Available |
| Cellular Location | Not Available |
| Gene Properties | |
| Chromosome Location | Not Available |
| Locus | Not Available |
| SNPs | Not Available |
| Gene Sequence | Not Available |
| Protein Properties | |
| Number of Residues | 54 |
| Molecular Weight | 5834.0 |
| Theoretical pI | 10.55 |
| Pfam Domain Function | Not Available |
| Signals |
|
| Transmembrane Regions |
|
| Protein Sequence |
>Similar to ATP synthase A chain (Protein 6) GQTWTLMLMSLILFIGSTNLLGLLPHSFTPTTQLSMNLGMAIPLWAGAVITGFR |
| External Links | |
| GenBank ID Protein | BAC56530.1 |
| UniProtKB/Swiss-Prot ID | Q85E89 |
| UniProtKB/Swiss-Prot Entry Name | Q85E89_BOVIN |
| PDB IDs | Not Available |
| GenBank Gene ID | AB099040 |
| GeneCard ID | Not Available |
| GenAtlas ID | Not Available |
| HGNC ID | Not Available |
| References | |
| General References | Not Available |