Identification
BMDB Protein ID BMDBP00722
Secondary Accession Numbers None
Name H+-transporting lysosomal 21kDa ATPase V0 subunit c transcript variant 1
Synonyms Not Available
Gene Name ATP6V0B
Protein Type Enzyme
Biological Properties
General Function Energy production and conversion
Specific Function Not Available
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location Not Available
Gene Properties
Chromosome Location 3
Locus Not Available
SNPs ATP6V0B
Gene Sequence Not Available
Protein Properties
Number of Residues 96
Molecular Weight 9769.0
Theoretical pI 8.49
Pfam Domain Function Not Available
Signals
  • None
Transmembrane Regions
  • 15-39
  • 59-89
Protein Sequence
>H+-transporting lysosomal 21kDa ATPase V0 subunit c transcript variant 1
IGGGVKAPRIKTKNLVSIIFCEAVAIYGIIMAIVISNMAEPFSATDPKAIGHRNYHAGYS
MFGAGLTVGLSNLFCGVCVGIVGSGAALADAQNPSL
GenBank ID Protein ABC55272.1
UniProtKB/Swiss-Prot ID A1XE98
UniProtKB/Swiss-Prot Entry Name A1XE98_BOVIN
PDB IDs Not Available
GenBank Gene ID DQ347563
GeneCard ID ATP6V0B
GenAtlas ID Not Available
HGNC ID Not Available
References
General References Not Available