You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Bovine Metabolome Database.
Identification
BMDB Protein ID BMDBP00735
Secondary Accession Numbers None
Name Similar to oligomycin-sensitivity conferral protein
Synonyms Not Available
Gene Name Not Available
Protein Type Enzyme
Biological Properties
General Function Energy production and conversion
Specific Function Not Available
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location Not Available
Gene Properties
Chromosome Location 1
Locus Not Available
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues 125
Molecular Weight 14150.0
Theoretical pI 10.19
Pfam Domain Function Not Available
Signals
  • None
Transmembrane Regions Not Available
Protein Sequence
>ATP synthase
VRPFAKLVRPPVQIYGIEGRYATALYSAASKQNKLEQVEKELLRVGQILKEPKMAASLLN
PYVKRSVKVKSLSDMTAKEKFSPLTSNLINLLAENGRLTNTPAVISAFYYHDECPPWRST
MHSYH
GenBank ID Protein BAC56570.1
UniProtKB/Swiss-Prot ID Q862C2
UniProtKB/Swiss-Prot Entry Name Q862C2_BOVIN
PDB IDs Not Available
GenBank Gene ID AB099080
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID Not Available
References
General References Not Available