Showing Protein Similar to oligomycin-sensitivity conferral protein (BMDBP00735)
Identification | |
---|---|
BMDB Protein ID | BMDBP00735 |
Secondary Accession Numbers | None |
Name | Similar to oligomycin-sensitivity conferral protein |
Synonyms | Not Available |
Gene Name | Not Available |
Protein Type | Enzyme |
Biological Properties | |
General Function | Energy production and conversion |
Specific Function | Not Available |
Pathways | Not Available |
Reactions | Not Available |
GO Classification | Not Available |
Cellular Location | Not Available |
Gene Properties | |
Chromosome Location | 1 |
Locus | Not Available |
SNPs | Not Available |
Gene Sequence | Not Available |
Protein Properties | |
Number of Residues | 125 |
Molecular Weight | 14150.0 |
Theoretical pI | 10.19 |
Pfam Domain Function | Not Available |
Signals |
|
Transmembrane Regions | Not Available |
Protein Sequence |
>ATP synthase VRPFAKLVRPPVQIYGIEGRYATALYSAASKQNKLEQVEKELLRVGQILKEPKMAASLLN PYVKRSVKVKSLSDMTAKEKFSPLTSNLINLLAENGRLTNTPAVISAFYYHDECPPWRST MHSYH |
External Links | |
GenBank ID Protein | BAC56570.1 |
UniProtKB/Swiss-Prot ID | Q862C2 |
UniProtKB/Swiss-Prot Entry Name | Q862C2_BOVIN |
PDB IDs | Not Available |
GenBank Gene ID | AB099080 |
GeneCard ID | Not Available |
GenAtlas ID | Not Available |
HGNC ID | Not Available |
References | |
General References | Not Available |