You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Bovine Metabolome Database.
Identification
BMDB Protein ID BMDBP00748
Secondary Accession Numbers None
Name ATP synthase subunit g, mitochondrial
Synonyms Not Available
Gene Name ATP5MG
Protein Type Enzyme
Biological Properties
General Function Involved in hydrogen ion transmembrane transporter acti
Specific Function Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core, and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(0) domain. Minor subunit located with subunit a in the membrane.
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location Not Available
Gene Properties
Chromosome Location 15
Locus Not Available
SNPs ATP5MG
Gene Sequence
>315 bp
ATGGCCGAGTTTGTCCGTAACCTCGCGGAAAAGGCCCCGGCGCTGGTCAACGCTGCTGTG
ACTTACTCGAAGCCTCGATTGGCCACGTTTTGGTACTATGCCAAGGTTGAGCTGGTTCCT
CCAACCCCTGCTGAGATCCCTACAGCAATTCAGAGCTTGAAAAAAATTATCAACAGTGCT
AAAACCGGTAGCTTCAAACAGCTCACTGTTAAGGAAGCTCTACTGAATGGTTTGGTGGCC
ACTGAGGTGTGGATGTGGTTTTATGTTGGCGAGATCATAGGCAAGCGTGGCATCATTGGC
TATGATGTTTGAAGA
Protein Properties
Number of Residues 103
Molecular Weight 11417.0
Theoretical pI 9.92
Pfam Domain Function Not Available
Signals
  • None
Transmembrane Regions
  • 6-31
  • 67-86
  • 98-117
  • 137-158
  • 164-184
  • 196-222
Protein Sequence
>ATP synthase subunit g, mitochondrial
MAEFVRNLAEKAPALVNAAVTYSKPRLATFWYYAKVELVPPTPAEIPTAIQSLKKIINSA
KTGSFKQLTVKEALLNGLVATEVWMWFYVGEIIGKRGIIGYDV
GenBank ID Protein AAB31108.3
UniProtKB/Swiss-Prot ID Q28852
UniProtKB/Swiss-Prot Entry Name ATP5L_BOVIN
PDB IDs Not Available
GenBank Gene ID S70448
GeneCard ID ATP5MG
GenAtlas ID Not Available
HGNC ID Not Available
References
General References Not Available