Showing Protein ATP synthase subunit epsilon, mitochondrial (BMDBP00760)
| Identification | |
|---|---|
| BMDB Protein ID | BMDBP00760 |
| Secondary Accession Numbers | None |
| Name | ATP synthase subunit epsilon, mitochondrial |
| Synonyms | Not Available |
| Gene Name | ATP5F1E |
| Protein Type | Enzyme |
| Biological Properties | |
| General Function | Involved in hydrogen ion transporting ATP synthase acti |
| Specific Function | Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core, and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(1) domain and of the central stalk which is part of the complex rotary element. Rotation of the central stalk against the surrounding alpha(3)beta(3) subunits leads to hydrolysis of ATP in three separate catalytic sites on the beta subunits. |
| Pathways | Not Available |
| Reactions | Not Available |
| GO Classification | Not Available |
| Cellular Location | Not Available |
| Gene Properties | |
| Chromosome Location | 13 |
| Locus | Not Available |
| SNPs | ATP5F1E |
| Gene Sequence | Not Available |
| Protein Properties | |
| Number of Residues | 51 |
| Molecular Weight | 5783.0 |
| Theoretical pI | 10.7 |
| Pfam Domain Function | Not Available |
| Signals |
|
| Transmembrane Regions | Not Available |
| Protein Sequence |
>ATP synthase subunit epsilon, mitochondrial MVAYWRQAGLSYIRYSQICAKAVRDALKTEFKANAMKTSGSTIKIVKVKKE |
| External Links | |
| GenBank ID Protein | CAA34849.1 |
| UniProtKB/Swiss-Prot ID | P05632 |
| UniProtKB/Swiss-Prot Entry Name | ATP5E_BOVIN |
| PDB IDs | |
| GenBank Gene ID | X16978 |
| GeneCard ID | ATP5F1E |
| GenAtlas ID | Not Available |
| HGNC ID | Not Available |
| References | |
| General References | Not Available |