Showing Protein Aldo-keto reductase family 1 member B1 (BMDBP00798)
Identification | |||||||||
---|---|---|---|---|---|---|---|---|---|
BMDB Protein ID | BMDBP00798 | ||||||||
Secondary Accession Numbers | None | ||||||||
Name | Aldo-keto reductase family 1 member B1 | ||||||||
Synonyms | Not Available | ||||||||
Gene Name | AKR1B1 | ||||||||
Protein Type | Enzyme | ||||||||
Biological Properties | |||||||||
General Function | Involved in 20-alpha-hydroxysteroid dehydrogenase activity | ||||||||
Specific Function | Catalyzes the NADPH-dependent reduction of a wide variety of carbonyl-containing compounds to their corresponding alcohols. Displays enzymatic activity towards endogenous metabolites such as aromatic and aliphatic aldehydes, ketones, monosacharides, bile acids and xenobiotics substrates. Key enzyme in the polyol pathway, catalyzes reduction of glucose to sorbitol during hyperglycemia. Reduces steroids and their derivatives and prostaglandins. Displays low enzymatic activity toward all-trans-retinal, 9-cis-retinal, and 13-cis-retinal. Catalyzes the reduction of diverse phospholipid aldehydes such as 1-palmitoyl-2-(5-oxovaleroyl)-sn -glycero-3-phosphoethanolamin (POVPC) and related phospholipid aldehydes that are generated from the oxydation of phosphotidylcholine and phosphatdyleethanolamides. Plays a role in detoxifying dietary and lipid-derived unsaturated carbonyls, such as crotonaldehyde, 4-hydroxynonenal, trans-2-hexenal, trans-2,4-hexadienal and their glutathione-conjugates carbonyls (GS-carbonyls). | ||||||||
Pathways |
|
||||||||
Reactions |
|
||||||||
GO Classification | Not Available | ||||||||
Cellular Location | Not Available | ||||||||
Gene Properties | |||||||||
Chromosome Location | 4 | ||||||||
Locus | Not Available | ||||||||
SNPs | AKR1B1 | ||||||||
Gene Sequence | Not Available | ||||||||
Protein Properties | |||||||||
Number of Residues | 315 | ||||||||
Molecular Weight | 35919.0 | ||||||||
Theoretical pI | 6.05 | ||||||||
Pfam Domain Function | Not Available | ||||||||
Signals |
|
||||||||
Transmembrane Regions | Not Available | ||||||||
Protein Sequence |
>Aldose reductase AHNIVLYTGAKMPILGLGTWKSPPGKVTEAVKVAIDLGYRHIDCAHVYQNENEVGLALQA KLQEQVVKREDLFIVSKLWCTYHDKDLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKD FFPLDEDGNVIPSEKDFVDTWTAMEELVDEGLVKAIGVSNFNHLQVEKILNKPGLKYKPA VNQIECHPYLTQEKLIQYCNSKGIVVTAYSPLGSPDRPWAKPEDPSILEDPRIKAIADKY NKTTAQVLIRFPIQRNLIVIPKSVTPERIAENFQVFDFELDKEDMNTLLSYNRDWRACAL VSCASHRDYPFHEEF |
||||||||
External Links | |||||||||
GenBank ID Protein | AAX09075.1 | ||||||||
UniProtKB/Swiss-Prot ID | P16116 | ||||||||
UniProtKB/Swiss-Prot Entry Name | ALDR_BOVIN | ||||||||
PDB IDs | |||||||||
GenBank Gene ID | BT021058 | ||||||||
GeneCard ID | AKR1B1 | ||||||||
GenAtlas ID | Not Available | ||||||||
HGNC ID | Not Available | ||||||||
References | |||||||||
General References | Not Available |