Showing Protein Prostaglandin E synthase 2 (BMDBP00802)
| Identification | |
|---|---|
| BMDB Protein ID | BMDBP00802 |
| Secondary Accession Numbers | None |
| Name | Prostaglandin E synthase 2 |
| Synonyms | Not Available |
| Gene Name | PTGES2 |
| Protein Type | Enzyme |
| Biological Properties | |
| General Function | Involved in prostaglandin-E synthase activity |
| Specific Function | Isomerase that catalyzes the conversion of PGH2 into the more stable prostaglandin E2 (PGE2). |
| Pathways |
|
| Reactions | Not Available |
| GO Classification | Not Available |
| Cellular Location | Not Available |
| Gene Properties | |
| Chromosome Location | 11 |
| Locus | Not Available |
| SNPs | PTGES2 |
| Gene Sequence | Not Available |
| Protein Properties | |
| Number of Residues | 372 |
| Molecular Weight | 41738.0 |
| Theoretical pI | 9.38 |
| Pfam Domain Function | Not Available |
| Signals |
|
| Transmembrane Regions |
|
| Protein Sequence |
>Prostaglandin E synthase 2 ERSATQLSLSSRLQLTLYQYKTAEIKFSSYRKVPILVAQEGESLQQLNDSSVIISALKTY LVSGQPLADIITYYPAMKA |
| External Links | |
| GenBank ID Protein | AAU04848.1 |
| UniProtKB/Swiss-Prot ID | Q66LN0 |
| UniProtKB/Swiss-Prot Entry Name | PGES2_BOVIN |
| PDB IDs | Not Available |
| GenBank Gene ID | DAAA02032171 |
| GeneCard ID | PTGES2 |
| GenAtlas ID | Not Available |
| HGNC ID | Not Available |
| References | |
| General References | Not Available |