Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Bovine Metabolome Database.
Identification
BMDB Protein ID BMDBP00819
Secondary Accession Numbers None
Name 72 kDa type IV collagenase
Synonyms Not Available
Gene Name MMP2
Protein Type Enzyme
Biological Properties
General Function Involved in calcium ion binding
Specific Function Ubiquitinous metalloproteinase that is involved in diverse functions such as remodeling of the vasculature, angiogenesis, tissue repair, tumor invasion, inflammation, and atherosclerotic plaque rupture. As well as degrading extracellular matrix proteins, can also act on several nonmatrix proteins such as big endothelial 1 and beta-type CGRP promoting vasoconstriction. Also cleaves KISS at a Gly-|-Leu bond. Appears to have a role in myocardial cell death pathways. Contributes to myocardial oxidative stress by regulating the activity of GSK3beta. Cleaves GSK3beta in vitro. Involved in the formation of the fibrovascular tissues (By similarity).
Pathways
  • GnRH Signaling Pathway
Reactions Not Available
GO Classification Not Available
Cellular Location Not Available
Gene Properties
Chromosome Location 18
Locus Not Available
SNPs MMP2
Gene Sequence
>1986 bp
ATGACCGAGGCGCGAGTGTCCCGGGGCGCGCTGGCCGCCCTTCTGCGGGCGCTCTGCGCC
CTGGGCTGCCTGTTGGGCCGTGCCGCCGCCGCGCCGTCGCCCATCATCAAATTTCCCGGC
GATGTCGCCCCCAAAACGGACAAAGAGTTGGCTGTGCAATACCTAAACACCTTCTACGGC
TGCCCCAAGGAGAGCTGTAACTTGTTTGTGCTGAAGGACACCCTGAAGAAGATGCAGAAG
TTCTTCGGGTTACCCCAGACAGGTGAACTGGACCAGAGCACCATTGAGACCATGCGGAAG
CCGCGCTGTGGCAACCCCGACGTGGCCAACTACAACTTCTTCCCCCGAAAGCCCAAGTGG
GACAAGAACCAGATCACATACAGGATCATTGGCTACACACCTGATCTGGACCCCCAGACA
GTGGATGATGCCTTCGCTCGTGCCTTCCAAGTCTGGAGCGATGTGACTCCGCTACGGTTT
TCTCGGATCCATGATGGAGAGGCTGACATCATGATCAACTTTGGCCGCTGGGAGCATGGA
GATGGGTACCCTTTTGATGGCAAAGACGGGCTCCTGGCTCATGCCTTCGCCCCGGGCCCT
GGAGTTGGGGGAGATTCCCACTTTGATGACGATGAGCTGCGGACCCTGGGAGAAGGACAA
GTGGTCCGTGTGAAGTACGGGAATGCTGACGGGGAATATTGCAAGTTCCCCTTCCGGTTC
AACGGCAAGGAGTACACCAGCTGCACAGACACAGGCCGCAGCGATGGCTTCCTCTGGTGT
TCCACCACATACAACTTTGACAAGGACGGCAAGTATGGCTTCTGCCCCCATGAAGCCCTG
TTCACCATGGGCGGCAACGCCGACGGACAGCCCTGCAAGTTCCCGTTCCGCTTCCAGGGC
ACGTCTTACGACAGTTGCACCACGGAGGGCCGCACGGACGGCTACCGCTGGTGTGGCACC
ACCGAGGACTACGACCGCGACAAGGAGTACGGCTTCTGCCCGGAGACCGCCATGTCCACT
GTGGGCGGGAACTCGGAAGGTGCCCCATGTGTCCTCCCCTTCACCTTCCTGGGCAACAAG
CACGAGAGCTGCACCAGCGCTGGCCGCAGTGATGGGAAGTTGTGGTGTGCGACCACCTCC
AACTACGATGATGACCGCAAGTGGGGCTTCTGCCCCGACCAAGGGTACAGCCTGTTCCTG
GTGGCAGCCCATGAGTTTGGCCATGCAATGGGGCTGGAGCACTCACAGGACCCTGGAGCC
CTGATGGCGCCCATTTATACCTACACCAAGAACTTCCGCCTGTCCCATGATGACATCCAG
GGCATCCAAGAACTCTATGGGGCCTCCCCTGACATTGATACTGGCACCGGCCCCACCCCA
ACCCTGGGCCCCGTCACTCCTGAGCTCTGCAAACAGGACATCGTCTTCGACGGCATCTCT
CAGATCCGTGGGGAGATCTTCTTCTTCAAGGACCGATTCATCTGGCGAACAGTGACACCA
CGTGACAAGCCCACAGGGCCCCTGCTGGTAGCCACATTCTGGCCTGAGCTGCCGGAAAAG
ATCGATGCTGTGTACGAAGACCCACAGGAGGAGAAGGCTGTGTTCTTTGCAGGGAACGAA
TACTGGGTCTATTCAGCCAGCACCCTGGAGCGAGGGTACCCCAAGCCACTGACCAGCCTG
GGGCTCCCCCCTGGTGTCCAGAAGGTGGATGCTGCCTTTAACTGGAGCAAGAACAAGAAG
ACGTACATCTTCGCCGGAGACAAATTCTGGAGATACAATGAGGTGAAGAAGAAAATGGAT
CCTGGCTTCCCCAAGCTCATCGCCGATGCCTGGAACGCCATCCCTGATAACCTGGATGCT
GTGGTGGACCTGCAGGGCGGGGGTCACAGCTACTTCTTCAAGGGCGCCTATTACCTGAAG
TTGGAGAACCAAAGTCTGAAGAGCGTGAAGTTCGGAAGCATCAAATCCGATTGGCTGGGC
TGCTGA
Protein Properties
Number of Residues 661
Molecular Weight 73777.0
Theoretical pI 5.34
Pfam Domain Function Not Available
Signals
  • 1-30
Transmembrane Regions Not Available
Protein Sequence
>72 kDa type IV collagenase
MTEARVSRGALAALLRALCALGCLLGRAAAAPSPIIKFPGDVAPKTDKELAVQYLNTFYG
CPKESCNLFVLKDTLKKMQKFFGLPQTGELDQSTIETMRKPRCGNPDVANYNFFPRKPKW
DKNQITYRIIGYTPDLDPQTVDDAFARAFQVWSDVTPLRFSRIHDGEADIMINFGRWEHG
DGYPFDGKDGLLAHAFAPGPGVGGDSHFDDDELRTLGEGQVVRVKYGNADGEYCKFPFRF
NGKEYTSCTDTGRSDGFLWCSTTYNFDKDGKYGFCPHEALFTMGGNADGQPCKFPFRFQG
TSYDSCTTEGRTDGYRWCGTTEDYDRDKEYGFCPETAMSTVGGNSEGAPCVLPFTFLGNK
HESCTSAGRSDGKLWCATTSNYDDDRKWGFCPDQGYSLFLVAAHEFGHAMGLEHSQDPGA
LMAPIYTYTKNFRLSHDDIQGIQELYGASPDIDTGTGPTPTLGPVTPELCKQDIVFDGIS
QIRGEIFFFKDRFIWRTVTPRDKPTGPLLVATFWPELPEKIDAVYEDPQEEKAVFFAGNE
YWVYSASTLERGYPKPLTSLGLPPGVQKVDAAFNWSKNKKTYIFAGDKFWRYNEVKKKMD
PGFPKLIADAWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWLG
C
GenBank ID Protein AAG28169.1
UniProtKB/Swiss-Prot ID Q9GLE5
UniProtKB/Swiss-Prot Entry Name MMP2_BOVIN
PDB IDs
GenBank Gene ID AF290428
GeneCard ID MMP2
GenAtlas ID Not Available
HGNC ID Not Available
References
General References Not Available